Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 164 (11 Dec 2019)
Sequence version 3 (18 May 2010)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Leucine-rich repeat and calponin homology domain-containing protein 1

Gene

LRCH1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Acts as a negative regulator of GTPase CDC42 by sequestering CDC42-guanine exchange factor DOCK8. Probably by preventing CDC42 activation, negatively regulates CD4+ T-cell migration.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Leucine-rich repeat and calponin homology domain-containing protein 1
Alternative name(s):
Calponin homology domain-containing protein 1
Neuronal protein 81
Short name:
NP81
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:LRCH1
Synonyms:CHDC1, KIAA1016
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 13

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000136141.14

Human Gene Nomenclature Database

More...
HGNCi
HGNC:20309 LRCH1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
610368 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9Y2L9

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cytoplasm

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
23143

Open Targets

More...
OpenTargetsi
ENSG00000136141

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134898200

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q9Y2L9 Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
LRCH1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
296439310

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000844781 – 728Leucine-rich repeat and calponin homology domain-containing protein 1Add BLAST728

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei370PhosphoserineCombined sources1
Modified residuei409PhosphoserineBy similarity1
Modified residuei532PhosphoserineCombined sources1
Modified residuei536PhosphoserineCombined sources1
Modified residuei568PhosphothreonineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9Y2L9

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9Y2L9

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q9Y2L9

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9Y2L9

PeptideAtlas

More...
PeptideAtlasi
Q9Y2L9

PRoteomics IDEntifications database

More...
PRIDEi
Q9Y2L9

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
29771
85839 [Q9Y2L9-1]
85840 [Q9Y2L9-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9Y2L9

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9Y2L9

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000136141 Expressed in 196 organ(s), highest expression level in cerebellar hemisphere

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9Y2L9 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9Y2L9 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA021536

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts (via LRR repeats) with unphosphorylated DOCK8 (via DHR-2 domain); the interaction prevents the interaction between DOCK8 and CDC42.

1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
Q8NF50-25EBI-2797324,EBI-10174653

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
116760, 27 interactors

Protein interaction database and analysis system

More...
IntActi
Q9Y2L9, 14 interactors

Molecular INTeraction database

More...
MINTi
Q9Y2L9

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000374447

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q9Y2L9 protein

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati98 – 119LRR 1Add BLAST22
Repeati121 – 143LRR 2Add BLAST23
Repeati144 – 166LRR 3Add BLAST23
Repeati167 – 187LRR 4Add BLAST21
Repeati189 – 210LRR 5Add BLAST22
Repeati212 – 234LRR 6Add BLAST23
Repeati235 – 255LRR 7Add BLAST21
Repeati257 – 278LRR 8Add BLAST22
Repeati283 – 304LRR 9Add BLAST22
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini576 – 692Calponin-homology (CH)PROSITE-ProRule annotationAdd BLAST117

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi21 – 36His-richAdd BLAST16
Compositional biasi37 – 54Gly-richAdd BLAST18

Keywords - Domaini

Leucine-rich repeat, Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0532 Eukaryota
KOG0619 Eukaryota
COG4886 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000159528

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000049055

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9Y2L9

Identification of Orthologs from Complete Genome Data

More...
OMAi
HATLDTR

Database of Orthologous Groups

More...
OrthoDBi
378148at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9Y2L9

TreeFam database of animal gene trees

More...
TreeFami
TF318428

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.418.10, 1 hit
3.80.10.10, 2 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR001715 CH-domain
IPR036872 CH_dom_sf
IPR001611 Leu-rich_rpt
IPR003591 Leu-rich_rpt_typical-subtyp
IPR032675 LRR_dom_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00307 CH, 1 hit
PF13855 LRR_8, 2 hits

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00033 CH, 1 hit
SM00369 LRR_TYP, 5 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF47576 SSF47576, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50021 CH, 1 hit
PS51450 LRR, 6 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9Y2L9-1) [UniParc]FASTAAdd to basket
Also known as: b, NP81b

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MATPGSEPQP FVPALSVATL HPLHHPHHHH HHHQHHGGTG APGGAGGGGG
60 70 80 90 100
GSGGFNLPLN RGLERALEEA ANSGGLNLSA RKLKEFPRTA APGHDLSDTV
110 120 130 140 150
QADLSKNRLV EVPMELCHFV SLEILNLYHN CIRVIPEAIV NLQMLTYLNL
160 170 180 190 200
SRNQLSALPA CLCGLPLKVL IASNNKLGSL PEEIGQLKQL MELDVSCNEI
210 220 230 240 250
TALPQQIGQL KSLRELNVRR NYLKVLPQEL VDLSLVKFDF SCNKVLVIPI
260 270 280 290 300
CFREMKQLQV LLLENNPLQS PPAQICTKGK VHIFKYLSIQ ACQIKTADSL
310 320 330 340 350
YLHTMERPHL HQHVEDGKKD SDSGVGSDNG DKRLSATEPS DEDTVSLNVP
360 370 380 390 400
MSNIMEEEQI IKEDSCHRLS PVKGEFHQEF QPEPSLLGDS TNSGEERDQF
410 420 430 440 450
TDRADGLHSE FMNYKARAED CEELLRIEED VHWQTEGIIS SSKDQDMDIA
460 470 480 490 500
MIEQLREAVD LLQDPNGLST DITERSVLNL YPMGSAEALE LQDSALNGQI
510 520 530 540 550
QLETSPVCEV QSDLTLQSNG SQYSPNEIRE NSPAVSPTTN STAPFGLKPR
560 570 580 590 600
SVFLRPQRNL ESIDPQFTIR RKMEQMREEK ELVEQLRESI EMRLKVSLHE
610 620 630 640 650
DLGAALMDGV VLCHLVNHIR PRSVASIHVP SPAVPKLSMA KCRRNVENFL
660 670 680 690 700
EACRKLGVPE ADLCSPCDIL QLDFRHIRKT VDTLLALGEK APPPTSALRS
710 720
RDLIGFCLVH ILFIVLVYIT YHWNALSA
Length:728
Mass (Da):80,875
Last modified:May 18, 2010 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iD4E29414E466DBF8
GO
Isoform 2 (identifier: Q9Y2L9-2) [UniParc]FASTAAdd to basket
Also known as: a, NP81a

The sequence of this isoform differs from the canonical sequence as follows:
     661-696: ADLCSPCDILQLDFRHIRKTVDTLLALGEKAPPPTS → EKLCLPHHILEEKGLVKVGITIQALLDITVTKALFT
     697-728: Missing.

Show »
Length:696
Mass (Da):77,225
Checksum:i696D5FD894F69381
GO
Isoform 3 (identifier: Q9Y2L9-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     551-551: S → SDPALILPPISFNTLTQAQTWDSSSYSVPSEGDSDN

Show »
Length:763
Mass (Da):84,611
Checksum:i3E357FFC469EB10F
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
C9J5B8C9J5B8_HUMAN
Leucine-rich repeat and calponin ho...
LRCH1
98Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JWE0C9JWE0_HUMAN
Leucine-rich repeat and calponin ho...
LRCH1
72Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAA76860 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti326G → V in AAI43884 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_051133234S → P3 PublicationsCorresponds to variant dbSNP:rs842381Ensembl.1
Natural variantiVAR_051134486A → S. Corresponds to variant dbSNP:rs11617392Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_044474551S → SDPALILPPISFNTLTQAQT WDSSSYSVPSEGDSDN in isoform 3. 1 Publication1
Alternative sequenceiVSP_010635661 – 696ADLCS…PPPTS → EKLCLPHHILEEKGLVKVGI TIQALLDITVTKALFT in isoform 2. 2 PublicationsAdd BLAST36
Alternative sequenceiVSP_010636697 – 728Missing in isoform 2. 2 PublicationsAdd BLAST32

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY050631 mRNA Translation: AAK95567.1
AY050632 mRNA Translation: AAK95568.1
AB023233 mRNA Translation: BAA76860.1 Different initiation.
AL136958 Genomic DNA No translation available.
AL138704 Genomic DNA No translation available.
AL359880 Genomic DNA No translation available.
BC112937 mRNA Translation: AAI12938.1
BC117472 mRNA Translation: AAI17473.1
BC143883 mRNA Translation: AAI43884.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS31972.1 [Q9Y2L9-1]
CCDS53865.1 [Q9Y2L9-3]
CCDS53866.1 [Q9Y2L9-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001157683.1, NM_001164211.1 [Q9Y2L9-3]
NP_001157685.1, NM_001164213.1 [Q9Y2L9-2]
NP_055931.1, NM_015116.2 [Q9Y2L9-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000311191; ENSP00000308493; ENSG00000136141 [Q9Y2L9-2]
ENST00000389797; ENSP00000374447; ENSG00000136141 [Q9Y2L9-3]
ENST00000389798; ENSP00000374448; ENSG00000136141 [Q9Y2L9-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
23143

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:23143

UCSC genome browser

More...
UCSCi
uc001vbj.4 human [Q9Y2L9-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY050631 mRNA Translation: AAK95567.1
AY050632 mRNA Translation: AAK95568.1
AB023233 mRNA Translation: BAA76860.1 Different initiation.
AL136958 Genomic DNA No translation available.
AL138704 Genomic DNA No translation available.
AL359880 Genomic DNA No translation available.
BC112937 mRNA Translation: AAI12938.1
BC117472 mRNA Translation: AAI17473.1
BC143883 mRNA Translation: AAI43884.1
CCDSiCCDS31972.1 [Q9Y2L9-1]
CCDS53865.1 [Q9Y2L9-3]
CCDS53866.1 [Q9Y2L9-2]
RefSeqiNP_001157683.1, NM_001164211.1 [Q9Y2L9-3]
NP_001157685.1, NM_001164213.1 [Q9Y2L9-2]
NP_055931.1, NM_015116.2 [Q9Y2L9-1]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGridi116760, 27 interactors
IntActiQ9Y2L9, 14 interactors
MINTiQ9Y2L9
STRINGi9606.ENSP00000374447

PTM databases

iPTMnetiQ9Y2L9
PhosphoSitePlusiQ9Y2L9

Polymorphism and mutation databases

BioMutaiLRCH1
DMDMi296439310

Proteomic databases

EPDiQ9Y2L9
jPOSTiQ9Y2L9
MassIVEiQ9Y2L9
PaxDbiQ9Y2L9
PeptideAtlasiQ9Y2L9
PRIDEiQ9Y2L9
ProteomicsDBi29771
85839 [Q9Y2L9-1]
85840 [Q9Y2L9-2]

Genome annotation databases

EnsembliENST00000311191; ENSP00000308493; ENSG00000136141 [Q9Y2L9-2]
ENST00000389797; ENSP00000374447; ENSG00000136141 [Q9Y2L9-3]
ENST00000389798; ENSP00000374448; ENSG00000136141 [Q9Y2L9-1]
GeneIDi23143
KEGGihsa:23143
UCSCiuc001vbj.4 human [Q9Y2L9-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
23143
DisGeNETi23143
EuPathDBiHostDB:ENSG00000136141.14

GeneCards: human genes, protein and diseases

More...
GeneCardsi
LRCH1
HGNCiHGNC:20309 LRCH1
HPAiHPA021536
MIMi610368 gene
neXtProtiNX_Q9Y2L9
OpenTargetsiENSG00000136141
PharmGKBiPA134898200

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0532 Eukaryota
KOG0619 Eukaryota
COG4886 LUCA
GeneTreeiENSGT00940000159528
HOGENOMiHOG000049055
InParanoidiQ9Y2L9
OMAiHATLDTR
OrthoDBi378148at2759
PhylomeDBiQ9Y2L9
TreeFamiTF318428

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
LRCH1 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
23143
PharosiQ9Y2L9 Tbio

Protein Ontology

More...
PROi
PR:Q9Y2L9
RNActiQ9Y2L9 protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000136141 Expressed in 196 organ(s), highest expression level in cerebellar hemisphere
ExpressionAtlasiQ9Y2L9 baseline and differential
GenevisibleiQ9Y2L9 HS

Family and domain databases

Gene3Di1.10.418.10, 1 hit
3.80.10.10, 2 hits
InterProiView protein in InterPro
IPR001715 CH-domain
IPR036872 CH_dom_sf
IPR001611 Leu-rich_rpt
IPR003591 Leu-rich_rpt_typical-subtyp
IPR032675 LRR_dom_sf
PfamiView protein in Pfam
PF00307 CH, 1 hit
PF13855 LRR_8, 2 hits
SMARTiView protein in SMART
SM00033 CH, 1 hit
SM00369 LRR_TYP, 5 hits
SUPFAMiSSF47576 SSF47576, 1 hit
PROSITEiView protein in PROSITE
PS50021 CH, 1 hit
PS51450 LRR, 6 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiLRCH1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9Y2L9
Secondary accession number(s): B7ZLL5
, F8W6F0, Q17R43, Q2KHR1, Q5TBU9, Q7Z5F6, Q7Z5F7
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 22, 2003
Last sequence update: May 18, 2010
Last modified: December 11, 2019
This is version 164 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. Human chromosome 13
    Human chromosome 13: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again