Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Serine/threonine-protein kinase SIK3

Gene

SIK3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Inhibits CREB activity by phosphorylating and inhibiting activity of TORCs, the CREB-specific coactivators, like CRTC2/TORC2 and CRTC3/TORC3 in response to cAMP signaling.1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the ‘Function’ section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Mg2+By similarity

<p>This subsection of the ‘Function’ section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Activated by phosphorylation on Thr-221 (By similarity). Inhibited by phosphorylation at Thr-469 and/or Ser-551, probably by PKA, which triggers interaction with 14-3-3 proteins (PubMed:29211348).By similarity1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei95ATPPROSITE-ProRule annotation1
<p>This subsection of the ‘Function’ section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei188Proton acceptorPROSITE-ProRule annotation1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi72 – 80ATPPROSITE-ProRule annotation9

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • ATP binding Source: UniProtKB
  • magnesium ion binding Source: UniProtKB
  • protein serine/threonine kinase activity Source: UniProtKB
  • tau-protein kinase activity Source: GO_Central

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionKinase, Serine/threonine-protein kinase, Transferase
LigandATP-binding, Magnesium, Metal-binding, Nucleotide-binding

Enzyme and pathway databases

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
Q9Y2K2

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q9Y2K2

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Serine/threonine-protein kinase SIK3Curated (EC:2.7.11.11 Publication)
Alternative name(s):
Salt-inducible kinase 3
Short name:
SIK-3
Serine/threonine-protein kinase QSK
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SIK3Imported
Synonyms:KIAA09991 Publication, QSK1 Publication
ORF Names:L19
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 11

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000160584.15

Human Gene Nomenclature Database

More...
HGNCi
HGNC:29165 SIK3

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
614776 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9Y2K2

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cytoplasm

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi221T → A: Prevents phosphorylation and activation by STK11/LKB1 complex. 1 Publication1
Mutagenesisi469T → A: Loss of interaction with 14-3-3 proteins in response to cAMP signaling and, thus, still able to inhibit TORC activity. 1 Publication1
Mutagenesisi469T → E: Loss of interaction with 14-3-3 proteins in response to cAMP signaling and, thus, still able to inhibit TORC activity although not as strongly as the A-469. 1 Publication1
Mutagenesisi551S → A: Loss of interaction with 14-3-3 proteins in response to cAMP signaling and, thus, still able to inhibit TORC activity. 1 Publication1
Mutagenesisi551S → E: Loss of interaction with 14-3-3 proteins in response to cAMP signaling and, thus, still able to inhibit TORC activity. 1 Publication1
Mutagenesisi626S → A: No effect on interaction with 14-3-3 proteins. No effect on regulation in response to cAMP signaling. 1 Publication1
Mutagenesisi626S → E: No effect on regulation in response to cAMP signaling. 1 Publication1

Organism-specific databases

DisGeNET

More...
DisGeNETi
23387

Open Targets

More...
OpenTargetsi
ENSG00000160584

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA165543631

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL6149

IUPHAR/BPS Guide to PHARMACOLOGY

More...
GuidetoPHARMACOLOGYi
2199

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
SIK3

Domain mapping of disease mutations (DMDM)

More...
DMDMi
115502238

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002522571 – 1321Serine/threonine-protein kinase SIK3Add BLAST1321

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei71PhosphothreonineCombined sources1
Modified residuei221Phosphothreonine; by LKB1Combined sources1 Publication1
Modified residuei469PhosphothreonineCombined sources1 Publication1
Modified residuei551PhosphoserineCombined sources1
Modified residuei591PhosphoserineBy similarity1
Modified residuei592PhosphoserineBy similarity1
Modified residuei626PhosphoserineCombined sources1
Modified residuei647PhosphoserineBy similarity1
Modified residuei866PhosphoserineCombined sources1
Modified residuei978PhosphoserineCombined sources1
Modified residuei986Omega-N-methylarginineBy similarity1
Isoform 2 (identifier: Q9Y2K2-6)
Modified residuei113PhosphothreonineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated at Thr-221 by STK11/LKB1 in complex with STE20-related adapter-alpha (STRADA) pseudo kinase and CAB39 (PubMed:14976552). Phosphorylated at Thr-469 and Ser-551 in repsonse to cAMP signaling, possibly by PKA (PubMed:29211348). This phosphorylation promotes interaction with 14-3-3 proteins and thus inactivation (PubMed:29211348).2 Publications

Keywords - PTMi

Methylation, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9Y2K2

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9Y2K2

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9Y2K2

PeptideAtlas

More...
PeptideAtlasi
Q9Y2K2

PRoteomics IDEntifications database

More...
PRIDEi
Q9Y2K2

ProteomicsDB human proteome resource

More...
ProteomicsDBi
85820

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9Y2K2

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9Y2K2

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000160584 Expressed in 231 organ(s), highest expression level in corpus callosum

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA045245
HPA048161

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Binds to and is activated by YWHAZ when phosphorylated on Thr-221 (PubMed:16306228). Interacts (when phosphorylated at Thr-469 and/or Ser-551) with 14-3-3 proteins; the interaction inhibits kinase activity towards TORCs (PubMed:29211348).2 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
116963, 23 interactors

Protein interaction database and analysis system

More...
IntActi
Q9Y2K2, 12 interactors

Molecular INTeraction database

More...
MINTi
Q9Y2K2

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000292055

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q9Y2K2

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9Y2K2

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini66 – 317Protein kinasePROSITE-ProRule annotationAdd BLAST252
Domaini344 – 384UBAPROSITE-ProRule annotationAdd BLAST41

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi2 – 54Ala-richPROSITE-ProRule annotationAdd BLAST53
Compositional biasi650 – 1016Gln-richPROSITE-ProRule annotationAdd BLAST367

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0586 Eukaryota
ENOG410XNQ0 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000157259

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000154056

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG079682

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9Y2K2

KEGG Orthology (KO)

More...
KOi
K19009

Database of Orthologous Groups

More...
OrthoDBi
1174178at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9Y2K2

TreeFam database of animal gene trees

More...
TreeFami
TF315213

Family and domain databases

Conserved Domains Database

More...
CDDi
cd14071 STKc_SIK, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR011009 Kinase-like_dom_sf
IPR000719 Prot_kinase_dom
IPR017441 Protein_kinase_ATP_BS
IPR008271 Ser/Thr_kinase_AS
IPR034672 SIK
IPR015940 UBA

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00069 Pkinase, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00220 S_TKc, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF56112 SSF56112, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00107 PROTEIN_KINASE_ATP, 1 hit
PS50011 PROTEIN_KINASE_DOM, 1 hit
PS00108 PROTEIN_KINASE_ST, 1 hit
PS50030 UBA, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9Y2K2-5) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAAAAASGAG GAAGAGTGGA GPAGRLLPPP APGSPAAPAA VSPAAGQPRP
60 70 80 90 100
PAPASRGPMP ARIGYYEIDR TIGKGNFAVV KRATHLVTKA KVAIKIIDKT
110 120 130 140 150
QLDEENLKKI FREVQIMKML CHPHIIRLYQ VMETERMIYL VTEYASGGEI
160 170 180 190 200
FDHLVAHGRM AEKEARRKFK QIVTAVYFCH CRNIVHRDLK AENLLLDANL
210 220 230 240 250
NIKIADFGFS NLFTPGQLLK TWCGSPPYAA PELFEGKEYD GPKVDIWSLG
260 270 280 290 300
VVLYVLVCGA LPFDGSTLQN LRARVLSGKF RIPFFMSTEC EHLIRHMLVL
310 320 330 340 350
DPNKRLSMEQ ICKHKWMKLG DADPNFDRLI AECQQLKEER QVDPLNEDVL
360 370 380 390 400
LAMEDMGLDK EQTLQSLRSD AYDHYSAIYS LLCDRHKRHK TLRLGALPSM
410 420 430 440 450
PRALAFQAPV NIQAEQAGTA MNISVPQVQL INPENQIVEP DGTLNLDSDE
460 470 480 490 500
GEEPSPEALV RYLSMRRHTV GVADPRTEVM EDLQKLLPGF PGVNPQAPFL
510 520 530 540 550
QVAPNVNFMH NLLPMQNLQP TGQLEYKEQS LLQPPTLQLL NGMGPLGRRA
560 570 580 590 600
SDGGANIQLH AQQLLKRPRG PSPLVTMTPA VPAVTPVDEE SSDGEPDQEA
610 620 630 640 650
VQSSTYKDSN TLHLPTERFS PVRRFSDGAA SIQAFKAHLE KMGNNSSIKQ
660 670 680 690 700
LQQECEQLQK MYGGQIDERT LEKTQQQHML YQQEQHHQIL QQQIQDSICP
710 720 730 740 750
PQPSPPLQAA CENQPALLTH QLQRLRIQPS SPPPNHPNNH LFRQPSNSPP
760 770 780 790 800
PMSSAMIQPH GAASSSQFQG LPSRSAIFQQ QPENCSSPPN VALTCLGMQQ
810 820 830 840 850
PAQSQQVTIQ VQEPVDMLSN MPGTAAGSSG RGISISPSAG QMQMQHRTNL
860 870 880 890 900
MATLSYGHRP LSKQLSADSA EAHSLNVNRF SPANYDQAHL HPHLFSDQSR
910 920 930 940 950
GSPSSYSPST GVGFSPTQAL KVPPLDQFPT FPPSAHQQPP HYTTSALQQA
960 970 980 990 1000
LLSPTPPDYT RHQQVPHILQ GLLSPRHSLT GHSDIRLPPT EFAQLIKRQQ
1010 1020 1030 1040 1050
QQRQQQQQQQ QQQEYQELFR HMNQGDAGSL APSLGGQSMT ERQALSYQNA
1060 1070 1080 1090 1100
DSYHHHTSPQ HLLQIRAQEC VSQASSPTPP HGYAHQPALM HSESMEEDCS
1110 1120 1130 1140 1150
CEGAKDGFQD SKSSSTLTKG CHDSPLLLST GGPGDPESLL GTVSHAQELG
1160 1170 1180 1190 1200
IHPYGHQPTA AFSKNKVPSR EPVIGNCMDR SSPGQAVELP DHNGLGYPAR
1210 1220 1230 1240 1250
PSVHEHHRPR ALQRHHTIQN SDDAYVQLDN LPGMSLVAGK ALSSARMSDA
1260 1270 1280 1290 1300
VLSQSSLMGS QQFQDGENEE CGASLGGHEH PDLSDGSQHL NSSCYPSTCI
1310 1320
TDILLSYKHP EVSFSMEQAG V
Length:1,321
Mass (Da):144,851
Last modified:March 28, 2018 - v4
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i84FA57F6BB5505DA
GO
Isoform 2 (identifier: Q9Y2K2-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-760: MAAAAASGAG...PMSSAMIQPH → MACSTPHGSN...SQPSLPISSR
     874-933: Missing.

Note: No experimental confirmation available.Combined sources
Show »
Length:641
Mass (Da):69,736
Checksum:iA07CFF76C242F373
GO
Isoform 3 (identifier: Q9Y2K2-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1171-1187: EPVIGNCMDRSSPGQAV → GKCLLTVEVLGQSALIN
     1188-1321: Missing.

Note: No experimental confirmation available.
Show »
Length:1,187
Mass (Da):130,347
Checksum:i3158F58032EC7E9B
GO
Isoform 4 (identifier: Q9Y2K2-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     365-412: Missing.
     603-603: S → RYLANRSKRHTLAMTNPTAEIPPDLQRQLGQQPFRSRVWPPHLVPDQHR
     874-933: Missing.

Note: No experimental confirmation available.
Show »
Length:1,261
Mass (Da):138,586
Checksum:i36FE1ABFEB26690E
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0Y4E8H0Y4E8_HUMAN
Serine/threonine-protein kinase SIK...
SIK3
1,363Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C038H7C038_HUMAN
Serine/threonine-protein kinase SIK...
SIK3
151Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C3X8H7C3X8_HUMAN
Serine/threonine-protein kinase SIK...
SIK3
506Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C042H7C042_HUMAN
Serine/threonine-protein kinase SIK...
SIK3
71Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH63887 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence AAI28511 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAA76843 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence BAB14006 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_035634389H → L in a breast cancer sample; somatic mutation. 1 PublicationCorresponds to variant dbSNP:rs376144593Ensembl.1
Natural variantiVAR_0516621098D → E. Corresponds to variant dbSNP:rs11216163Ensembl.1
Natural variantiVAR_0516631136P → R1 PublicationCorresponds to variant dbSNP:rs12225230Ensembl.1
Natural variantiVAR_0356351161A → V in a breast cancer sample; somatic mutation. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0594121 – 760MAAAA…MIQPH → MACSTPHGSNRRLPRKCHFS LPTRTPTLCTSLRSVSPLCA GSQMGLRASRPSKLTWKKWA TTAASNSCSRSVSSCRRCTG GRLMKEPWRRPSSSICYTSR SSTIKFSSNKFKTLSVLLSH LHLFRLHVKISQPSLPISSR in isoform 2. Add BLAST760
Alternative sequenceiVSP_059413365 – 412Missing in isoform 4. Add BLAST48
Alternative sequenceiVSP_059414603S → RYLANRSKRHTLAMTNPTAE IPPDLQRQLGQQPFRSRVWP PHLVPDQHR in isoform 4. 1
Alternative sequenceiVSP_059415874 – 933Missing in isoform 2 and isoform 4. Add BLAST60
Alternative sequenceiVSP_0594161171 – 1187EPVIG…PGQAV → GKCLLTVEVLGQSALIN in isoform 3. Add BLAST17
Alternative sequenceiVSP_0594171188 – 1321Missing in isoform 3. Add BLAST134

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB023216 mRNA Translation: BAA76843.2 Different initiation.
AP000936 Genomic DNA No translation available.
AP003070 Genomic DNA No translation available.
AP006216 Genomic DNA No translation available.
BC035583 mRNA Translation: AAH35583.3
BC063887 mRNA Translation: AAH63887.1 Different initiation.
BC086858 mRNA Translation: AAH86858.1
BC128510 mRNA Translation: AAI28511.1 Different initiation.
AB209327 mRNA Translation: BAD92564.1
AK022302 mRNA Translation: BAB14006.1 Different initiation.
AY598338 mRNA Translation: AAT06749.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS60974.1 [Q9Y2K2-8]
CCDS8379.2 [Q9Y2K2-5]

NCBI Reference Sequences

More...
RefSeqi
NP_001268678.1, NM_001281749.1 [Q9Y2K2-8]
NP_079440.3, NM_025164.4 [Q9Y2K2-5]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.167451

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000375300; ENSP00000364449; ENSG00000160584 [Q9Y2K2-5]
ENST00000446921; ENSP00000390442; ENSG00000160584 [Q9Y2K2-8]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
23387

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:23387

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB023216 mRNA Translation: BAA76843.2 Different initiation.
AP000936 Genomic DNA No translation available.
AP003070 Genomic DNA No translation available.
AP006216 Genomic DNA No translation available.
BC035583 mRNA Translation: AAH35583.3
BC063887 mRNA Translation: AAH63887.1 Different initiation.
BC086858 mRNA Translation: AAH86858.1
BC128510 mRNA Translation: AAI28511.1 Different initiation.
AB209327 mRNA Translation: BAD92564.1
AK022302 mRNA Translation: BAB14006.1 Different initiation.
AY598338 mRNA Translation: AAT06749.1
CCDSiCCDS60974.1 [Q9Y2K2-8]
CCDS8379.2 [Q9Y2K2-5]
RefSeqiNP_001268678.1, NM_001281749.1 [Q9Y2K2-8]
NP_079440.3, NM_025164.4 [Q9Y2K2-5]
UniGeneiHs.167451

3D structure databases

ProteinModelPortaliQ9Y2K2
SMRiQ9Y2K2
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116963, 23 interactors
IntActiQ9Y2K2, 12 interactors
MINTiQ9Y2K2
STRINGi9606.ENSP00000292055

Chemistry databases

ChEMBLiCHEMBL6149
GuidetoPHARMACOLOGYi2199

PTM databases

iPTMnetiQ9Y2K2
PhosphoSitePlusiQ9Y2K2

Polymorphism and mutation databases

BioMutaiSIK3
DMDMi115502238

Proteomic databases

EPDiQ9Y2K2
jPOSTiQ9Y2K2
PaxDbiQ9Y2K2
PeptideAtlasiQ9Y2K2
PRIDEiQ9Y2K2
ProteomicsDBi85820

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
23387
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000375300; ENSP00000364449; ENSG00000160584 [Q9Y2K2-5]
ENST00000446921; ENSP00000390442; ENSG00000160584 [Q9Y2K2-8]
GeneIDi23387
KEGGihsa:23387

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
23387
DisGeNETi23387
EuPathDBiHostDB:ENSG00000160584.15

GeneCards: human genes, protein and diseases

More...
GeneCardsi
SIK3

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0004310
HGNCiHGNC:29165 SIK3
HPAiHPA045245
HPA048161
MIMi614776 gene
neXtProtiNX_Q9Y2K2
OpenTargetsiENSG00000160584
PharmGKBiPA165543631

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0586 Eukaryota
ENOG410XNQ0 LUCA
GeneTreeiENSGT00940000157259
HOGENOMiHOG000154056
HOVERGENiHBG079682
InParanoidiQ9Y2K2
KOiK19009
OrthoDBi1174178at2759
PhylomeDBiQ9Y2K2
TreeFamiTF315213

Enzyme and pathway databases

SignaLinkiQ9Y2K2
SIGNORiQ9Y2K2

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
SIK3 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
KIAA0999

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
23387

Protein Ontology

More...
PROi
PR:Q9Y2K2

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000160584 Expressed in 231 organ(s), highest expression level in corpus callosum

Family and domain databases

CDDicd14071 STKc_SIK, 1 hit
InterProiView protein in InterPro
IPR011009 Kinase-like_dom_sf
IPR000719 Prot_kinase_dom
IPR017441 Protein_kinase_ATP_BS
IPR008271 Ser/Thr_kinase_AS
IPR034672 SIK
IPR015940 UBA
PfamiView protein in Pfam
PF00069 Pkinase, 1 hit
SMARTiView protein in SMART
SM00220 S_TKc, 1 hit
SUPFAMiSSF56112 SSF56112, 1 hit
PROSITEiView protein in PROSITE
PS00107 PROTEIN_KINASE_ATP, 1 hit
PS50011 PROTEIN_KINASE_DOM, 1 hit
PS00108 PROTEIN_KINASE_ST, 1 hit
PS50030 UBA, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSIK3_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9Y2K2
Secondary accession number(s): A1A5A8
, H0Y494, J3KPC8, Q59FY2, Q5M9N1, Q6P3R6, Q8IYM8, Q9HA50
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 3, 2006
Last sequence update: March 28, 2018
Last modified: January 16, 2019
This is version 152 of the entry and version 4 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human and mouse protein kinases
    Human and mouse protein kinases: classification and index
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again