Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Angiomotin-like protein 2

Gene

AMOTL2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Regulates the translocation of phosphorylated SRC to peripheral cell-matrix adhesion sites. Required for proper architecture of actin filaments. Inhibits the Wnt/beta-catenin signaling pathway, probably by recruiting CTNNB1 to recycling endosomes and hence preventing its translocation to the nucleus. Participates in angiogenesis. May play a role in the polarity, proliferation and migration of endothelial cells. Selectively promotes FGF-induced MAPK activation through SRC.3 Publications

GO - Molecular functioni

GO - Biological processi

Keywordsi

Biological processWnt signaling pathway

Enzyme and pathway databases

ReactomeiR-HSA-2028269 Signaling by Hippo

Names & Taxonomyi

Protein namesi
Recommended name:
Angiomotin-like protein 2
Alternative name(s):
Leman coiled-coil protein
Short name:
LCCP
Gene namesi
Name:AMOTL2
Synonyms:KIAA0989
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 3

Organism-specific databases

EuPathDBiHostDB:ENSG00000114019.14
HGNCiHGNC:17812 AMOTL2
MIMi614658 gene
neXtProtiNX_Q9Y2J4

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Endosome

Pathology & Biotechi

Organism-specific databases

DisGeNETi51421
OpenTargetsiENSG00000114019
PharmGKBiPA24775

Polymorphism and mutation databases

BioMutaiAMOTL2
DMDMi308153633

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001906721 – 779Angiomotin-like protein 2Add BLAST779

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei107Phosphotyrosine; by FGFR1By similarity1
Modified residuei759PhosphoserineCombined sources1
Modified residuei762PhosphoserineBy similarity1

Post-translational modificationi

Phosphorylation at Tyr-107 is necessary for efficient binding to SRC and synergistically functioning with SRC to activate the downstream MAPK pathway.By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ9Y2J4
PaxDbiQ9Y2J4
PeptideAtlasiQ9Y2J4
PRIDEiQ9Y2J4
ProteomicsDBi85814
85815 [Q9Y2J4-2]
85816 [Q9Y2J4-3]

PTM databases

iPTMnetiQ9Y2J4
PhosphoSitePlusiQ9Y2J4

Expressioni

Gene expression databases

BgeeiENSG00000114019 Expressed in 236 organ(s), highest expression level in mammary gland
CleanExiHS_AMOTL2
ExpressionAtlasiQ9Y2J4 baseline and differential
GenevisibleiQ9Y2J4 HS

Organism-specific databases

HPAiHPA063027

Interactioni

Subunit structurei

Interacts with SRC.1 Publication

Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

BioGridi119530, 91 interactors
CORUMiQ9Y2J4
DIPiDIP-57510N
IntActiQ9Y2J4, 109 interactors
MINTiQ9Y2J4
STRINGi9606.ENSP00000249883

Structurei

3D structure databases

ProteinModelPortaliQ9Y2J4
SMRiQ9Y2J4
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili308 – 581Sequence analysisAdd BLAST274

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi776 – 779PDZ-binding4

Sequence similaritiesi

Belongs to the angiomotin family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiENOG410IEF3 Eukaryota
ENOG410ZEXZ LUCA
GeneTreeiENSGT00530000063846
HOGENOMiHOG000233789
HOVERGENiHBG066485
InParanoidiQ9Y2J4
KOiK06104
OMAiRHQEMEN
OrthoDBiEOG091G07Y9
PhylomeDBiQ9Y2J4
TreeFamiTF333368

Family and domain databases

InterProiView protein in InterPro
IPR009114 Angiomotin
IPR024646 Angiomotin_C
PfamiView protein in Pfam
PF12240 Angiomotin_C, 1 hit
PRINTSiPR01807 ANGIOMOTIN

Sequences (4+)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9Y2J4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MRTLEDSSGT VLHRLIQEQL RYGNLTETRT LLAIQQQALR GGAGTGGTGS
60 70 80 90 100
PQASLEILAP EDSQVLQQAT RQEPQGQEHQ GGENHLAENT LYRLCPQPSK
110 120 130 140 150
GEELPTYEEA KAHSQYYAAQ QAGTRPHAGD RDPRGAPGGS RRQDEALREL
160 170 180 190 200
RHGHVRSLSE RLLQLSLERN GARAPSHMSS SHSFPQLARN QQGPPLRGPP
210 220 230 240 250
AEGPESRGPP PQYPHVVLAH ETTTAVTDPR YRARGSPHFQ HAEVRILQAQ
260 270 280 290 300
VPPVFLQQQQ QYQYLQQSQE HPPPPHPAAL GHGPLSSLSP PAVEGPVSAQ
310 320 330 340 350
ASSATSGSAH LAQMEAVLRE NARLQRDNER LQRELESSAE KAGRIEKLES
360 370 380 390 400
EIQRLSEAHE SLTRASSKRE ALEKTMRNKM DSEMRRLQDF NRDLRERLES
410 420 430 440 450
ANRRLASKTQ EAQAGSQDMV AKLLAQSYEQ QQEQEKLERE MALLRGAIED
460 470 480 490 500
QRRRAELLEQ ALGNAQGRAA RAEEELRKKQ AYVEKVERLQ QALGQLQAAC
510 520 530 540 550
EKREQLELRL RTRLEQELKA LRAQQRQAGA PGGSSGSGGS PELSALRLSE
560 570 580 590 600
QLREKEEQIL ALEADMTKWE QKYLEERAMR QFAMDAAATA AAQRDTTLIR
610 620 630 640 650
HSPQPSPSSS FNEGLLTGGH RHQEMESRLK VLHAQILEKD AVIKVLQQRS
660 670 680 690 700
RRDPGKAIQG SLRPAKSVPS VFAAAAAGTQ GWQGLSSSER QTADAPARLT
710 720 730 740 750
TDRAPTEEPV VTAPPAAHAK HGSRDGSTQT EGPPDSTSTC LPPEPDSLLG
760 770
CSSSQRAASL DSVATSRVQD LSDMVEILI
Length:779
Mass (Da):85,764
Last modified:October 5, 2010 - v3
Checksum:i665BE69FD7757CEF
GO
Isoform 2 (identifier: Q9Y2J4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     701-701: T → TA

Show »
Length:780
Mass (Da):85,835
Checksum:iBC8B569E10247B01
GO
Isoform 3 (identifier: Q9Y2J4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     525-526: Missing.

Note: No experimental confirmation available.
Show »
Length:777
Mass (Da):85,480
Checksum:i0B454D787F017544
GO
Isoform 4 (identifier: Q9Y2J4-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MTGRKASGGTPCTLRKGAPIITLGKNWTERLAAGDSVGCSGARCHRPLSRQLCASQRSM

Note: No experimental confirmation available.
Show »
Length:837
Mass (Da):91,817
Checksum:i18CC1B88CF34F90A
GO

Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D6RCL7D6RCL7_HUMAN
Angiomotin-like protein 2
AMOTL2
198Annotation score:
D6RF61D6RF61_HUMAN
Angiomotin-like protein 2
AMOTL2
151Annotation score:
D6RBK2D6RBK2_HUMAN
Angiomotin-like protein 2
AMOTL2
127Annotation score:
D6RJA4D6RJA4_HUMAN
Angiomotin-like protein 2
AMOTL2
144Annotation score:
D6RIC7D6RIC7_HUMAN
Angiomotin-like protein 2
AMOTL2
123Annotation score:
D6RFG0D6RFG0_HUMAN
Angiomotin-like protein 2
AMOTL2
33Annotation score:

Sequence cautioni

The sequence AAH11454 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAA76833 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence BAD97318 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti666K → E in BAH12987 (PubMed:14702039).Curated1
Sequence conflicti680Q → K in AAD56361 (PubMed:12406577).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_055497227T → I. Corresponds to variant dbSNP:rs35377537Ensembl.1
Natural variantiVAR_055498342A → P. Corresponds to variant dbSNP:rs2303635Ensembl.1
Natural variantiVAR_055499415G → S. Corresponds to variant dbSNP:rs2241559Ensembl.1
Natural variantiVAR_023535731E → D4 PublicationsCorresponds to variant dbSNP:rs1353776Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0440811M → MTGRKASGGTPCTLRKGAPI ITLGKNWTERLAAGDSVGCS GARCHRPLSRQLCASQRSM in isoform 4. 1 Publication1
Alternative sequenceiVSP_037826525 – 526Missing in isoform 3. 1 Publication2
Alternative sequenceiVSP_015711701T → TA in isoform 2. 2 Publications1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB023206 mRNA Translation: BAA76833.1 Different initiation.
AK291616 mRNA Translation: BAF84305.1
AK299270 mRNA Translation: BAH12987.1
AK223598 mRNA Translation: BAD97318.1 Different initiation.
AF175966 mRNA Translation: AAD56361.2
AC010207 Genomic DNA No translation available.
BC011454 mRNA Translation: AAH11454.1 Different initiation.
CCDSiCCDS33860.1 [Q9Y2J4-2]
CCDS63783.1 [Q9Y2J4-3]
CCDS63784.1 [Q9Y2J4-4]
CCDS87138.1 [Q9Y2J4-1]
RefSeqiNP_001265612.1, NM_001278683.1 [Q9Y2J4-4]
NP_001265614.1, NM_001278685.1 [Q9Y2J4-3]
NP_057285.3, NM_016201.3 [Q9Y2J4-2]
XP_006713717.1, XM_006713654.2 [Q9Y2J4-1]
XP_011511183.1, XM_011512881.1
XP_016862069.1, XM_017006580.1 [Q9Y2J4-2]
XP_016862070.1, XM_017006581.1 [Q9Y2J4-2]
XP_016862071.1, XM_017006582.1 [Q9Y2J4-2]
UniGeneiHs.426312
Hs.713601

Genome annotation databases

EnsembliENST00000249883; ENSP00000249883; ENSG00000114019 [Q9Y2J4-2]
ENST00000422605; ENSP00000409999; ENSG00000114019 [Q9Y2J4-1]
ENST00000513145; ENSP00000425475; ENSG00000114019 [Q9Y2J4-3]
ENST00000514516; ENSP00000424765; ENSG00000114019 [Q9Y2J4-4]
GeneIDi51421
KEGGihsa:51421
UCSCiuc003eqf.4 human [Q9Y2J4-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB023206 mRNA Translation: BAA76833.1 Different initiation.
AK291616 mRNA Translation: BAF84305.1
AK299270 mRNA Translation: BAH12987.1
AK223598 mRNA Translation: BAD97318.1 Different initiation.
AF175966 mRNA Translation: AAD56361.2
AC010207 Genomic DNA No translation available.
BC011454 mRNA Translation: AAH11454.1 Different initiation.
CCDSiCCDS33860.1 [Q9Y2J4-2]
CCDS63783.1 [Q9Y2J4-3]
CCDS63784.1 [Q9Y2J4-4]
CCDS87138.1 [Q9Y2J4-1]
RefSeqiNP_001265612.1, NM_001278683.1 [Q9Y2J4-4]
NP_001265614.1, NM_001278685.1 [Q9Y2J4-3]
NP_057285.3, NM_016201.3 [Q9Y2J4-2]
XP_006713717.1, XM_006713654.2 [Q9Y2J4-1]
XP_011511183.1, XM_011512881.1
XP_016862069.1, XM_017006580.1 [Q9Y2J4-2]
XP_016862070.1, XM_017006581.1 [Q9Y2J4-2]
XP_016862071.1, XM_017006582.1 [Q9Y2J4-2]
UniGeneiHs.426312
Hs.713601

3D structure databases

ProteinModelPortaliQ9Y2J4
SMRiQ9Y2J4
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi119530, 91 interactors
CORUMiQ9Y2J4
DIPiDIP-57510N
IntActiQ9Y2J4, 109 interactors
MINTiQ9Y2J4
STRINGi9606.ENSP00000249883

PTM databases

iPTMnetiQ9Y2J4
PhosphoSitePlusiQ9Y2J4

Polymorphism and mutation databases

BioMutaiAMOTL2
DMDMi308153633

Proteomic databases

EPDiQ9Y2J4
PaxDbiQ9Y2J4
PeptideAtlasiQ9Y2J4
PRIDEiQ9Y2J4
ProteomicsDBi85814
85815 [Q9Y2J4-2]
85816 [Q9Y2J4-3]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000249883; ENSP00000249883; ENSG00000114019 [Q9Y2J4-2]
ENST00000422605; ENSP00000409999; ENSG00000114019 [Q9Y2J4-1]
ENST00000513145; ENSP00000425475; ENSG00000114019 [Q9Y2J4-3]
ENST00000514516; ENSP00000424765; ENSG00000114019 [Q9Y2J4-4]
GeneIDi51421
KEGGihsa:51421
UCSCiuc003eqf.4 human [Q9Y2J4-1]

Organism-specific databases

CTDi51421
DisGeNETi51421
EuPathDBiHostDB:ENSG00000114019.14
GeneCardsiAMOTL2
HGNCiHGNC:17812 AMOTL2
HPAiHPA063027
MIMi614658 gene
neXtProtiNX_Q9Y2J4
OpenTargetsiENSG00000114019
PharmGKBiPA24775
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IEF3 Eukaryota
ENOG410ZEXZ LUCA
GeneTreeiENSGT00530000063846
HOGENOMiHOG000233789
HOVERGENiHBG066485
InParanoidiQ9Y2J4
KOiK06104
OMAiRHQEMEN
OrthoDBiEOG091G07Y9
PhylomeDBiQ9Y2J4
TreeFamiTF333368

Enzyme and pathway databases

ReactomeiR-HSA-2028269 Signaling by Hippo

Miscellaneous databases

ChiTaRSiAMOTL2 human
GeneWikiiAMOTL2
GenomeRNAii51421
PROiPR:Q9Y2J4
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000114019 Expressed in 236 organ(s), highest expression level in mammary gland
CleanExiHS_AMOTL2
ExpressionAtlasiQ9Y2J4 baseline and differential
GenevisibleiQ9Y2J4 HS

Family and domain databases

InterProiView protein in InterPro
IPR009114 Angiomotin
IPR024646 Angiomotin_C
PfamiView protein in Pfam
PF12240 Angiomotin_C, 1 hit
PRINTSiPR01807 ANGIOMOTIN
ProtoNetiSearch...

Entry informationi

Entry nameiAMOL2_HUMAN
AccessioniPrimary (citable) accession number: Q9Y2J4
Secondary accession number(s): A8K6F1
, B7Z5Q1, E9PHW3, Q53EP1, Q96F99, Q9UKB4
Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 27, 2005
Last sequence update: October 5, 2010
Last modified: November 7, 2018
This is version 142 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again