Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 160 (31 Jul 2019)
Sequence version 3 (22 Jul 2008)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Disks large-associated protein 4

Gene

DLGAP4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May play a role in the molecular organization of synapses and neuronal cell signaling. Could be an adapter protein linking ion channel to the subsynaptic cytoskeleton. May induce enrichment of PSD-95/SAP90 at the plasma membrane.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-6794361 Neurexins and neuroligins

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Disks large-associated protein 4
Short name:
DAP-4
Alternative name(s):
PSD-95/SAP90-binding protein 4
SAP90/PSD-95-associated protein 4
Short name:
SAPAP-4
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:DLGAP4
Synonyms:DAP4, KIAA0964, SAPAP4
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 20

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:24476 DLGAP4

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
616191 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9Y2H0

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
22839

Open Targets

More...
OpenTargetsi
ENSG00000080845

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134891458

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
DLGAP4

Domain mapping of disease mutations (DMDM)

More...
DMDMi
205831580

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001742971 – 992Disks large-associated protein 4Add BLAST992

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei206PhosphoserineBy similarity1
Modified residuei207PhosphoserineBy similarity1
Modified residuei291Omega-N-methylarginineBy similarity1
Modified residuei378PhosphoserineBy similarity1
Modified residuei381PhosphoserineBy similarity1
Modified residuei388PhosphoserineBy similarity1
Modified residuei405PhosphoserineBy similarity1
Modified residuei415PhosphoserineBy similarity1
Modified residuei421PhosphoserineBy similarity1
Modified residuei580PhosphoserineBy similarity1
Modified residuei581PhosphoserineBy similarity1
Modified residuei609PhosphoserineBy similarity1
Modified residuei611PhosphoserineBy similarity1
Modified residuei665PhosphoserineCombined sources1
Modified residuei744PhosphoserineCombined sources1
Modified residuei915PhosphothreonineCombined sources1
Modified residuei973PhosphoserineCombined sources1

Keywords - PTMi

Methylation, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9Y2H0

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9Y2H0

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q9Y2H0

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9Y2H0

PeptideAtlas

More...
PeptideAtlasi
Q9Y2H0

PRoteomics IDEntifications database

More...
PRIDEi
Q9Y2H0

ProteomicsDB human proteome resource

More...
ProteomicsDBi
85777 [Q9Y2H0-2]
85778 [Q9Y2H0-1]
85779 [Q9Y2H0-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9Y2H0

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9Y2H0

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q9Y2H0

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000080845 Expressed in 214 organ(s), highest expression level in esophagogastric junction muscularis propria

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9Y2H0 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9Y2H0 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA054105
HPA056378

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with DLG1 and DLG4/PSD-95.

By similarity

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
116513, 19 interactors

Protein interaction database and analysis system

More...
IntActi
Q9Y2H0, 41 interactors

Molecular INTeraction database

More...
MINTi
Q9Y2H0

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000363023

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9Y2H0

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi267 – 274Poly-Pro8

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the SAPAP family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3971 Eukaryota
ENOG4111JKV LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000155308

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9Y2H0

Identification of Orthologs from Complete Genome Data

More...
OMAi
YIKRGSW

Database of Orthologous Groups

More...
OrthoDBi
285447at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9Y2H0

TreeFam database of animal gene trees

More...
TreeFami
TF321382

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR030527 DLGAP4
IPR005026 SAPAP

The PANTHER Classification System

More...
PANTHERi
PTHR12353 PTHR12353, 1 hit
PTHR12353:SF19 PTHR12353:SF19, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF03359 GKAP, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9Y2H0-2) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MKGLGDSRPR HLSDSLDPPH EPLFAGTDRN PYLLSPTEAF AREARFPGQN
60 70 80 90 100
TLPGDGLFPL NNQLPPPSST FPRIHYNSHF EVPEESPFPS HAQATKINRL
110 120 130 140 150
PANLLDQFEK QLPIHRDGFS TLQFPRGEAK ARGESPGRIR HLVHSVQRLF
160 170 180 190 200
FTKAPSLEGT AGKVGGNGSK KGGMEDGKGR RAKSKERAKA GEPKRRSRSN
210 220 230 240 250
ISGWWSSDDN LDGEAGAFRS SGPASGLMTL GRQAERSQPR YFMHAYNTIS
260 270 280 290 300
GHMLKTTKNN TTELTAPPPP PAPPATCPSL GVGTDTNYVK RGSWSTLTLS
310 320 330 340 350
HAHEVCQKTS ATLDKSLLKS KSCHQGLAYH YLQVPGGGGE WSTTLLSPRE
360 370 380 390 400
TDAAAEGPIP CRRMRSGSYI KAMGDEDSDE SGGSPKPSPK TAARRQSYLR
410 420 430 440 450
ATQQSLGEQS NPRRSLDRLD SVDMLLPSKC PSWEEDYTPV SDSLNDSSCI
460 470 480 490 500
SQIFGQASLI PQLFGHEQQV REAELSDQYE AACESACSEA ESTAAETLDL
510 520 530 540 550
PLPSYFRSRS HSYLRAIQAG CSQEEDSVSL QSLSPPPSTG SLSNSRTLPS
560 570 580 590 600
SSCLVAYKKT PPPVPPRTTS KPFISVTVQS STESAQDTYL DSQDHKSEVT
610 620 630 640 650
SQSGLSNSSD SLDSSTRPPS VTRGGVAPAP EAPEPPPKHA ALKSEQGTLT
660 670 680 690 700
SSESHPEAAP KRKLSSIGIQ VDCIQPVPKE EPSPATKFQS IGVQVEDDWR
710 720 730 740 750
SSVPSHSMSS RRDTDSDTQD ANDSSCKSSE RSLPDCTPHP NSISIDAGPR
760 770 780 790 800
QAPKIAQIKR NLSYGDNSDP ALEASSLPPP DPWLETSSSS PAEPAQPGAC
810 820 830 840 850
RRDGYWFLKL LQAETERLEG WCCQMDKETK ENNLSEEVLG KVLSAVGSAQ
860 870 880 890 900
LLMSQKFQQF RGLCEQNLNP DANPRPTAQD LAGFWDLLQL SIEDISMKFD
910 920 930 940 950
ELYHLKANSW QLVETPEKRK EEKKPPPPVP KKPAKSKPAV SRDKASDASD
960 970 980 990
KQRQEARKRL LAAKRAASVR QNSATESADS IEIYVPEAQT RL
Length:992
Mass (Da):108,012
Last modified:July 22, 2008 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iF0EBFBE0DE1AC814
GO
Isoform 2 (identifier: Q9Y2H0-1) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     671-700: VDCIQPVPKEEPSPATKFQSIGVQVEDDWR → ERTRRNGSHLSEDNGPKAIDVMAPSSE

Show »
Length:989
Mass (Da):107,567
Checksum:iB2FD9A2103E052EB
GO
Isoform 3 (identifier: Q9Y2H0-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-539: Missing.
     540-550: GSLSNSRTLPS → MALCLELLKQC

Show »
Length:453
Mass (Da):49,478
Checksum:i877C20CA747800EB
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F8WF49F8WF49_HUMAN
Disks large-associated protein 4
DLGAP4
244Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0B4J2C2A0A0B4J2C2_HUMAN
Discs, large (Drosophila) homolog-a...
DLGAP4 hCG_2020065
285Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087X246A0A087X246_HUMAN
Disks large-associated protein 4
DLGAP4
125Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WWE6A0A087WWE6_HUMAN
Disks large-associated protein 4
DLGAP4
46Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAA76808 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti229T → I in BAA76808 (PubMed:10231032).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_057716486A → T. Corresponds to variant dbSNP:rs6019652Ensembl.1
Natural variantiVAR_057717861R → Q. Corresponds to variant dbSNP:rs2275807Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0349101 – 539Missing in isoform 3. 1 PublicationAdd BLAST539
Alternative sequenceiVSP_034911540 – 550GSLSNSRTLPS → MALCLELLKQC in isoform 3. 1 PublicationAdd BLAST11
Alternative sequenceiVSP_006013671 – 700VDCIQ…EDDWR → ERTRRNGSHLSEDNGPKAID VMAPSSE in isoform 2. 1 PublicationAdd BLAST30

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB023181 mRNA Translation: BAA76808.2 Different initiation.
AL390374 Genomic DNA No translation available.
AL050318 Genomic DNA No translation available.
CH471077 Genomic DNA Translation: EAW76140.1
CH471077 Genomic DNA Translation: EAW76135.1
CH471077 Genomic DNA Translation: EAW76136.1
BC108706 mRNA Translation: AAI08707.1
BC153874 mRNA Translation: AAI53875.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS13274.1 [Q9Y2H0-1]
CCDS13275.1 [Q9Y2H0-3]

NCBI Reference Sequences

More...
RefSeqi
NP_001035951.1, NM_001042486.3
NP_055717.2, NM_014902.5 [Q9Y2H0-1]
NP_892118.1, NM_183006.3 [Q9Y2H0-3]
XP_011526990.1, XM_011528688.2

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000339266; ENSP00000341633; ENSG00000080845 [Q9Y2H0-2]
ENST00000340491; ENSP00000345700; ENSG00000080845 [Q9Y2H0-3]
ENST00000373907; ENSP00000363014; ENSG00000080845 [Q9Y2H0-2]
ENST00000373913; ENSP00000363023; ENSG00000080845 [Q9Y2H0-1]
ENST00000401952; ENSP00000384954; ENSG00000080845 [Q9Y2H0-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
22839

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:22839

UCSC genome browser

More...
UCSCi
uc002xff.4 human [Q9Y2H0-2]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB023181 mRNA Translation: BAA76808.2 Different initiation.
AL390374 Genomic DNA No translation available.
AL050318 Genomic DNA No translation available.
CH471077 Genomic DNA Translation: EAW76140.1
CH471077 Genomic DNA Translation: EAW76135.1
CH471077 Genomic DNA Translation: EAW76136.1
BC108706 mRNA Translation: AAI08707.1
BC153874 mRNA Translation: AAI53875.1
CCDSiCCDS13274.1 [Q9Y2H0-1]
CCDS13275.1 [Q9Y2H0-3]
RefSeqiNP_001035951.1, NM_001042486.3
NP_055717.2, NM_014902.5 [Q9Y2H0-1]
NP_892118.1, NM_183006.3 [Q9Y2H0-3]
XP_011526990.1, XM_011528688.2

3D structure databases

SMRiQ9Y2H0
ModBaseiSearch...

Protein-protein interaction databases

BioGridi116513, 19 interactors
IntActiQ9Y2H0, 41 interactors
MINTiQ9Y2H0
STRINGi9606.ENSP00000363023

PTM databases

iPTMnetiQ9Y2H0
PhosphoSitePlusiQ9Y2H0
SwissPalmiQ9Y2H0

Polymorphism and mutation databases

BioMutaiDLGAP4
DMDMi205831580

Proteomic databases

EPDiQ9Y2H0
jPOSTiQ9Y2H0
MaxQBiQ9Y2H0
PaxDbiQ9Y2H0
PeptideAtlasiQ9Y2H0
PRIDEiQ9Y2H0
ProteomicsDBi85777 [Q9Y2H0-2]
85778 [Q9Y2H0-1]
85779 [Q9Y2H0-3]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
22839
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000339266; ENSP00000341633; ENSG00000080845 [Q9Y2H0-2]
ENST00000340491; ENSP00000345700; ENSG00000080845 [Q9Y2H0-3]
ENST00000373907; ENSP00000363014; ENSG00000080845 [Q9Y2H0-2]
ENST00000373913; ENSP00000363023; ENSG00000080845 [Q9Y2H0-1]
ENST00000401952; ENSP00000384954; ENSG00000080845 [Q9Y2H0-1]
GeneIDi22839
KEGGihsa:22839
UCSCiuc002xff.4 human [Q9Y2H0-2]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
22839
DisGeNETi22839

GeneCards: human genes, protein and diseases

More...
GeneCardsi
DLGAP4
HGNCiHGNC:24476 DLGAP4
HPAiHPA054105
HPA056378
MIMi616191 gene
neXtProtiNX_Q9Y2H0
OpenTargetsiENSG00000080845
PharmGKBiPA134891458

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3971 Eukaryota
ENOG4111JKV LUCA
GeneTreeiENSGT00940000155308
InParanoidiQ9Y2H0
OMAiYIKRGSW
OrthoDBi285447at2759
PhylomeDBiQ9Y2H0
TreeFamiTF321382

Enzyme and pathway databases

ReactomeiR-HSA-6794361 Neurexins and neuroligins

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
DLGAP4 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
DLGAP4

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
22839

Protein Ontology

More...
PROi
PR:Q9Y2H0

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000080845 Expressed in 214 organ(s), highest expression level in esophagogastric junction muscularis propria
ExpressionAtlasiQ9Y2H0 baseline and differential
GenevisibleiQ9Y2H0 HS

Family and domain databases

InterProiView protein in InterPro
IPR030527 DLGAP4
IPR005026 SAPAP
PANTHERiPTHR12353 PTHR12353, 1 hit
PTHR12353:SF19 PTHR12353:SF19, 1 hit
PfamiView protein in Pfam
PF03359 GKAP, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiDLGP4_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9Y2H0
Secondary accession number(s): E1P5T5
, Q5QPG4, Q5T2Y4, Q5T2Y5, Q9H137, Q9H138, Q9H1L7
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 26, 2001
Last sequence update: July 22, 2008
Last modified: July 31, 2019
This is version 160 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 20
    Human chromosome 20: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again