Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

VPS9 domain-containing protein 1

Gene

VPS9D1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

GO - Molecular functioni

  • GTPase activator activity Source: UniProtKB-KW
  • transporter activity Source: ProtInc

GO - Biological processi

Keywordsi

Molecular functionGTPase activation

Names & Taxonomyi

Protein namesi
Recommended name:
VPS9 domain-containing protein 1
Alternative name(s):
Protein ATP-BL
Gene namesi
Name:VPS9D1
Synonyms:ATPBL, C16orf7
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 16

Organism-specific databases

EuPathDBiHostDB:ENSG00000075399.12
HGNCiHGNC:13526 VPS9D1
neXtProtiNX_Q9Y2B5

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000075399
PharmGKBiPA25562

Polymorphism and mutation databases

BioMutaiVPS9D1
DMDMi317373349

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000792791 – 631VPS9 domain-containing protein 1Add BLAST631

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei116PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ9Y2B5
PaxDbiQ9Y2B5
PeptideAtlasiQ9Y2B5
PRIDEiQ9Y2B5
ProteomicsDBi85720
85721 [Q9Y2B5-2]

PTM databases

iPTMnetiQ9Y2B5
PhosphoSitePlusiQ9Y2B5

Expressioni

Tissue specificityi

Ubiquitous.1 Publication

Gene expression databases

BgeeiENSG00000075399 Expressed in 177 organ(s), highest expression level in blood
CleanExiHS_C16orf7
ExpressionAtlasiQ9Y2B5 baseline and differential
GenevisibleiQ9Y2B5 HS

Organism-specific databases

HPAiHPA007847
HPA023620

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
MAP1LC3AQ9H4924EBI-9031083,EBI-720768

Protein-protein interaction databases

BioGridi114969, 3 interactors
IntActiQ9Y2B5, 28 interactors

Structurei

3D structure databases

ProteinModelPortaliQ9Y2B5
SMRiQ9Y2B5
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini467 – 630VPS9PROSITE-ProRule annotationAdd BLAST164

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili187 – 221Sequence analysisAdd BLAST35

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiENOG410IT2G Eukaryota
ENOG410YGIS LUCA
GeneTreeiENSGT00390000015057
InParanoidiQ9Y2B5
OMAiRVICACA
OrthoDBiEOG091G0G38
PhylomeDBiQ9Y2B5
TreeFamiTF332037

Family and domain databases

Gene3Di1.20.1050.80, 1 hit
InterProiView protein in InterPro
IPR003123 VPS9
IPR037191 VPS9_dom_sf
PfamiView protein in Pfam
PF02204 VPS9, 1 hit
SMARTiView protein in SMART
SM00167 VPS9, 1 hit
SUPFAMiSSF109993 SSF109993, 1 hit
PROSITEiView protein in PROSITE
PS51205 VPS9, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9Y2B5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAAAAGDGTV KPLQSAMKLA NGAIELDTGN RPREAYTEYL RSIHYISQVL
60 70 80 90 100
LEEVETTKEA GETVPPDTSK MLKLAQQCLE RAQSTAAKLG KTRLKPTMPA
110 120 130 140 150
AAPIPQPAGR HRRVYSDEGG KLSPFLPPEI FQKLQGAESQ SCKKELTPLE
160 170 180 190 200
EASLQNQKLK AAYEARMARL DPSQAMQKTS LTLSLQRQMM ENLVIAKARE
210 220 230 240 250
ETLQRKMEER RLRLQEAANR RFCSQVALTP EEREQRALYA AILEYEQDHD
260 270 280 290 300
WPKHWKAKLK RNPGDLSLVT SLVSHLLSLP DHPIAQLLRR LQCSVYSALY
310 320 330 340 350
PAVSRAAAPA PGCCPPTPNP GSRRLRPSQS LHCMLSPPEP SAAPRPQDSP
360 370 380 390 400
PTPPLQPGPV GSPSPLGDTA SGLPDKDSSF EDLEQFLGTS ERQGRGRGVQ
410 420 430 440 450
PEPQLQQLKT AVEEIHNAVD RLLSLTLLAF EGLNTAASKD RCLACIEEPF
460 470 480 490 500
FSPLWPLLLA LYRSVHRARE AALSRSMELY RNAPPTAIGI PTKLLPQNPE
510 520 530 540 550
AKGATGYPYC AAAQELGLLV LESCPQKKLE CIVRTLRIIC VCAEDYCPTP
560 570 580 590 600
EATPQAGPPP IAAAAIGADD LLPILSFVVL RSGLPQLVSE CAALEEFIHE
610 620 630
GYLIGEEGYC LTSLQSALSY VELLPRGGLA K
Length:631
Mass (Da):68,956
Last modified:January 11, 2011 - v2
Checksum:i0C302E7BA496B27A
GO
Isoform 2 (identifier: Q9Y2B5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-33: MAAAAGDGTVKPLQSAMKLANGAIELDTGNRPR → MLLCPAQKTV...DPTLSLSWTQ

Note: No experimental confirmation available.
Show »
Length:662
Mass (Da):72,933
Checksum:iDB9CF0ABE288A070
GO

Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H3BM58H3BM58_HUMAN
Chromosome 16 open reading frame 7,...
VPS9D1 C16orf7, hCG_15602
561Annotation score:
H3BQI2H3BQI2_HUMAN
VPS9 domain-containing protein 1
VPS9D1
232Annotation score:
H3BNK1H3BNK1_HUMAN
VPS9 domain-containing protein 1
VPS9D1
52Annotation score:

Sequence cautioni

The sequence BAA76711 differs from that shown. Reason: Frameshift at several positions.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti225 – 226QV → KF in BAA76711 (PubMed:10231027).Curated2
Sequence conflicti392R → P in BAA76711 (PubMed:10231027).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0403061 – 33MAAAA…GNRPR → MLLCPAQKTVFRLQLTTAAQ CLWVYLRDKQVVVFLAYPTR APGRNNGVTSLHWPDPTLSL SWTQ in isoform 2. 1 PublicationAdd BLAST33

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB018551 mRNA Translation: BAA76711.1 Frameshift.
AC010538 Genomic DNA No translation available.
CCDSiCCDS42220.1 [Q9Y2B5-1]
RefSeqiNP_004904.2, NM_004913.2 [Q9Y2B5-1]
UniGeneiHs.164410

Genome annotation databases

EnsembliENST00000389386; ENSP00000374037; ENSG00000075399 [Q9Y2B5-1]
GeneIDi9605
KEGGihsa:9605
UCSCiuc002fom.2 human [Q9Y2B5-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB018551 mRNA Translation: BAA76711.1 Frameshift.
AC010538 Genomic DNA No translation available.
CCDSiCCDS42220.1 [Q9Y2B5-1]
RefSeqiNP_004904.2, NM_004913.2 [Q9Y2B5-1]
UniGeneiHs.164410

3D structure databases

ProteinModelPortaliQ9Y2B5
SMRiQ9Y2B5
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi114969, 3 interactors
IntActiQ9Y2B5, 28 interactors

PTM databases

iPTMnetiQ9Y2B5
PhosphoSitePlusiQ9Y2B5

Polymorphism and mutation databases

BioMutaiVPS9D1
DMDMi317373349

Proteomic databases

EPDiQ9Y2B5
PaxDbiQ9Y2B5
PeptideAtlasiQ9Y2B5
PRIDEiQ9Y2B5
ProteomicsDBi85720
85721 [Q9Y2B5-2]

Protocols and materials databases

DNASUi9605
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000389386; ENSP00000374037; ENSG00000075399 [Q9Y2B5-1]
GeneIDi9605
KEGGihsa:9605
UCSCiuc002fom.2 human [Q9Y2B5-1]

Organism-specific databases

CTDi9605
EuPathDBiHostDB:ENSG00000075399.12
GeneCardsiVPS9D1
H-InvDBiHIX0202318
HGNCiHGNC:13526 VPS9D1
HPAiHPA007847
HPA023620
neXtProtiNX_Q9Y2B5
OpenTargetsiENSG00000075399
PharmGKBiPA25562
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IT2G Eukaryota
ENOG410YGIS LUCA
GeneTreeiENSGT00390000015057
InParanoidiQ9Y2B5
OMAiRVICACA
OrthoDBiEOG091G0G38
PhylomeDBiQ9Y2B5
TreeFamiTF332037

Miscellaneous databases

ChiTaRSiVPS9D1 human
GeneWikiiC16orf7
GenomeRNAii9605
PROiPR:Q9Y2B5

Gene expression databases

BgeeiENSG00000075399 Expressed in 177 organ(s), highest expression level in blood
CleanExiHS_C16orf7
ExpressionAtlasiQ9Y2B5 baseline and differential
GenevisibleiQ9Y2B5 HS

Family and domain databases

Gene3Di1.20.1050.80, 1 hit
InterProiView protein in InterPro
IPR003123 VPS9
IPR037191 VPS9_dom_sf
PfamiView protein in Pfam
PF02204 VPS9, 1 hit
SMARTiView protein in SMART
SM00167 VPS9, 1 hit
SUPFAMiSSF109993 SSF109993, 1 hit
PROSITEiView protein in PROSITE
PS51205 VPS9, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiVP9D1_HUMAN
AccessioniPrimary (citable) accession number: Q9Y2B5
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 19, 2005
Last sequence update: January 11, 2011
Last modified: November 7, 2018
This is version 110 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again