UniProtKB - Q9Y242 (TCF19_HUMAN)

BLAST

>sp|Q9Y242|TCF19_HUMAN Transcription factor 19 OS=Homo sapiens OX=9606 GN=TCF19 PE=1 SV=2
MLPCFQLLRIGGGRGGDLYTFHPPAGAGCTYRLGHRADLCDVALRPQQEPGLISGIHAEL
HAEPRGDDWRVSLEDHSSQGTLVNNVRLPRGHRLELSDGDLLTFGPEGPPGTSPSEFYFM
FQQVRVKPQDFAAITIPRSRGEARVGAGFRPMLPSQGAPQRPLSTFSPAPKATLILNSIG
SLSKLRPQPLTFSPSWGGPKSLPVPAPPGEMGTTPSAPPQRNRRKSVHRVLAELDDESEP
PENPPPVLMEPRKKLRVDKAPLTPTGNRRGRPRKYPVSAPMAPPAVGGGEPCAAPCCCLP
QEETVAWVQCDGCDVWFHVACVGCSIQAAREADFRCPGCRAGIQT

Align
Format
Add to basket Added to basket
History
Entry version 151 (07 Nov 2018)
Sequence version 2 (20 Feb 2007)
Previous versions | rss
Other tutorials and videos
Help video
Feedback

Protein

Transcription factor 19

Gene

TCF19

Organism

Homo sapiens (Human)

Status

Reviewed-Annotation score: -Experimental evidence at protein levelⁱ

Functionⁱ

Potential trans-activating factor that could play an important role in the transcription of genes required for the later stages of cell cycle progression.

Regions

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Zinc fingerⁱ	296 – 339	PHD-typeAdd BLAST		44

GO - Molecular functionⁱ

DNA-binding transcription factor activity
Source: ProtInc
Traceable author statementⁱ
- 1868030
metal ion binding Source: UniProtKB-KW

View the complete GO annotation on QuickGO ...

GO - Biological processⁱ

cell proliferation
Source: ProtInc
Traceable author statementⁱ
- 1868030
regulation of transcription by RNA polymerase II
Source: ProtInc
Traceable author statementⁱ
- 1868030

View the complete GO annotation on QuickGO ...

Keywordsⁱ

Biological process	Transcription, Transcription regulation
Ligand	Metal-binding, Zinc

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: Transcription factor 19 Short name: TCF-19 Alternative name(s): Transcription factor SC1
Gene namesⁱ	Name:TCF19 Synonyms:SC1
Organismⁱ	Homo sapiens (Human)
Taxonomic identifierⁱ	9606 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Primates › Haplorrhini › Simiiformes › Catarrhini › Hominoidea › Hominidae › Homininae › Homo
Proteomesⁱ	UP000005640 Componentⁱ: Chromosome 6

Organism-specific databases

EuPathDBⁱ	HostDB:ENSG00000137310.11
Human Gene Nomenclature Database More...HGNCⁱ	HGNC:11629 TCF19
MIMⁱ	600912 gene
neXtProtⁱ	NX_Q9Y242

Keywords - Cellular componentⁱ

Nucleus

Pathology & Biotechⁱ

Organism-specific databases

DisGeNET More...DisGeNETⁱ	6941
Open Targets More...OpenTargetsⁱ	ENSG00000137310
PharmGKBⁱ	PA36384

Polymorphism and mutation databases

BioMutaⁱ	TCF19
DMDMⁱ	126302606

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Graphical view	Length
ChainⁱPRO_0000059327	1 – 345	Transcription factor 19Add BLAST		345

Amino acid modifications

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Modified residueⁱ	78	PhosphoserineCombined sources		1

Keywords - PTMⁱ

Phosphoprotein

Proteomic databases

MaxQB - The MaxQuant DataBase More...MaxQBⁱ	Q9Y242
PaxDbⁱ	Q9Y242
PeptideAtlas More...PeptideAtlasⁱ	Q9Y242
PRIDEⁱ	Q9Y242
ProteomicsDBⁱ	85640

PTM databases

iPTMnetⁱ	Q9Y242
PhosphoSitePlusⁱ	Q9Y242

Expressionⁱ

Developmental stageⁱ

Growth regulated.

Gene expression databases

Bgeeⁱ	ENSG00000137310 Expressed in 130 organ(s), highest expression level in mucosa of transverse colon
ExpressionAtlasⁱ	Q9Y242 baseline and differential
Genevisibleⁱ	Q9Y242 HS

Interactionⁱ

Binary interactionsⁱ

With	Entry	#Exp.	IntAct	Notes
GOLGA2	Q08379	3	EBI-7413767,EBI-618309

With

Entry

#Exp.

IntAct

Notes

GOLGA2

Q08379

EBI-7413767,EBI-618309

Protein-protein interaction databases

BioGridⁱ	112801, 13 interactors
IntActⁱ	Q9Y242, 16 interactors
Molecular INTeraction database More...MINTⁱ	Q9Y242
STRINGⁱ	9606.ENSP00000365431

Structureⁱ

3D structure databases

ProteinModelPortalⁱ	Q9Y242
SMRⁱ	Q9Y242
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Family & Domainsⁱ

Domains and Repeats

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Domainⁱ	31 – 88	FHAPROSITE-ProRule annotationAdd BLAST		58

Compositional bias

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Compositional biasⁱ	187 – 300	Pro-richAdd BLAST		114

Zinc finger

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Zinc fingerⁱ	296 – 339	PHD-typeAdd BLAST		44

Keywords - Domainⁱ

Zinc-finger

Phylogenomic databases

eggNOGⁱ	ENOG410IXZZ Eukaryota ENOG4111J5W LUCA
Ensembl GeneTree More...GeneTreeⁱ	ENSGT00390000015391
HOVERGENⁱ	HBG054343
InParanoidⁱ	Q9Y242
OMAⁱ	ADFHCGC
Database of Orthologous Groups More...OrthoDBⁱ	EOG091G05D2
PhylomeDBⁱ	Q9Y242
TreeFamⁱ	TF334697

Family and domain databases

Conserved Domains Database More...CDDⁱ	cd00060 FHA, 1 hit cd15609 PHD_TCF19, 1 hit
Gene3Dⁱ	3.30.40.10, 1 hit
InterProⁱ	View protein in InterPro IPR000253 FHA_dom IPR008984 SMAD_FHA_dom_sf IPR039095 TCF19_PHD IPR019786 Zinc_finger_PHD-type_CS IPR011011 Znf_FYVE_PHD IPR001965 Znf_PHD IPR013083 Znf_RING/FYVE/PHD
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF00498 FHA, 1 hit
SMARTⁱ	View protein in SMART SM00240 FHA, 1 hit SM00249 PHD, 1 hit
SUPFAMⁱ	SSF49879 SSF49879, 1 hit SSF57903 SSF57903, 1 hit
PROSITEⁱ	View protein in PROSITE PS50006 FHA_DOMAIN, 1 hit PS01359 ZF_PHD_1, 1 hit

Sequence (1+)ⁱ

Sequence statusⁱ: Complete.

This entry has 1 described isoform and 3 potential isoforms that are computationally mapped.Show all Align All

Q9Y242-1 [UniParc]FASTA Add to basket

« Hide

        10         20         30         40         50
MLPCFQLLRI GGGRGGDLYT FHPPAGAGCT YRLGHRADLC DVALRPQQEP 
        60         70         80         90        100
GLISGIHAEL HAEPRGDDWR VSLEDHSSQG TLVNNVRLPR GHRLELSDGD 
       110        120        130        140        150
LLTFGPEGPP GTSPSEFYFM FQQVRVKPQD FAAITIPRSR GEARVGAGFR 
       160        170        180        190        200
PMLPSQGAPQ RPLSTFSPAP KATLILNSIG SLSKLRPQPL TFSPSWGGPK 
       210        220        230        240        250
SLPVPAPPGE MGTTPSAPPQ RNRRKSVHRV LAELDDESEP PENPPPVLME 
       260        270        280        290        300
PRKKLRVDKA PLTPTGNRRG RPRKYPVSAP MAPPAVGGGE PCAAPCCCLP 
       310        320        330        340 
QEETVAWVQC DGCDVWFHVA CVGCSIQAAR EADFRCPGCR AGIQT

Length:345

Mass (Da):37,184

Last modified:February 20, 2007 - v2

Checksum:ⁱB5730936A842B83A

Computationally mapped potential isoform sequencesⁱ

There are 3 potential isoforms mapped to this entry.BLAST Align Show all Add to basket

Entry	Entry name	Protein names	Gene names	Length	Annotation

D2IYK5	D2IYK5_HUMAN	TCF19 TCF19 (Transcription factor 19) (Transcription factor 19 (SC1), isoform CRA_a) (Transcription factor 19 isoform 1) (Transcription factor 19 isoform 2)	TCF19 hCG_25998	345	Annotation score:
A0A0G2JIJ7	A0A0G2JIJ7_HUMAN	TCF19 TCF19 (Transcription factor 19)	TCF19	345	Annotation score:
H0YFN0	H0YFN0_HUMAN	Transcription factor 19 Transcription factor 19	TCF19	217	Annotation score:

Sequence cautionⁱ

The sequence AAB60363 differs from that shown. Reason: Frameshift at positions 288, 290 and 291.Curated

The sequence AAB60363 differs from that shown. Reason: Frameshift at position 288.Curated

Experimental Info

Feature key	Position(s)	DescriptionActions	Length
Sequence conflictⁱ	27	A → V in AAB60363 (Ref. 3) Curated	1
Sequence conflictⁱ	123	Q → N in AAB19475 (PubMed:1868030).Curated	1
Sequence conflictⁱ	193	S → T in AAB19475 (PubMed:1868030).Curated	1
Sequence conflictⁱ	268	R → A in AAB60363 (Ref. 3) Curated	1

Natural variant

Feature key	Position(s)	DescriptionActions	Length
Natural variantⁱVAR_051604	109	P → S1 PublicationCorresponds to variant dbSNP:rs7750641Ensembl.	1
Natural variantⁱVAR_017741	211	M → V8 PublicationsCorresponds to variant dbSNP:rs2073721Ensembl.	1
Natural variantⁱVAR_017742	241	P → L3 PublicationsCorresponds to variant dbSNP:rs2073724Ensembl.	1

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	S53374 mRNA Translation: AAB19475.2 Frameshift. AB029516 Genomic DNA Translation: BAA82324.1 AB029517 Genomic DNA Translation: BAA82325.1 AB029518 Genomic DNA Translation: BAA82326.1 AB029519 Genomic DNA Translation: BAA82327.1 U25826 Genomic DNA Translation: AAB60363.1 Frameshift. BA000025 Genomic DNA Translation: BAB63312.1 AB088113 Genomic DNA Translation: BAC54945.1 AB103619 Genomic DNA Translation: BAF31280.1 AB202105 Genomic DNA Translation: BAE78629.1 BT007247 mRNA Translation: AAP35911.1 AL662833 Genomic DNA No translation available. AL662844 Genomic DNA No translation available. AL773544 Genomic DNA No translation available. BX088580 Genomic DNA No translation available. CR759815 Genomic DNA No translation available. CR388229 Genomic DNA No translation available. CR753819 Genomic DNA No translation available. CR847794 Genomic DNA No translation available. CH471081 Genomic DNA Translation: EAX03363.1 BC002493 mRNA Translation: AAH02493.1 BC033086 mRNA Translation: AAH33086.1 BC044632 mRNA Translation: AAH44632.1
The Consensus CDS (CCDS) project More...CCDSⁱ	CCDS43446.1
PIRⁱ	A61188
NCBI Reference Sequences More...RefSeqⁱ	NP_001070979.1, NM_001077511.1 NP_001305837.1, NM_001318908.1 NP_009040.2, NM_007109.2
UniGeneⁱ	Hs.584807

Genome annotation databases

Ensemblⁱ	ENST00000376255; ENSP00000365431; ENSG00000137310 ENST00000376257; ENSP00000365433; ENSG00000137310
GeneIDⁱ	6941
KEGGⁱ	hsa:6941
UCSC genome browser More...UCSCⁱ	uc003nss.4 human

Keywords - Coding sequence diversityⁱ

Polymorphism

Similar proteinsⁱ

100% Identity
90% Identity
50% Identity

Protein	Similar proteins		Species	Score	Length	Source
Q9Y242	TCF19		HUMAN		345	UniRef100_Q9Y242

Protein	Similar proteins		Species	Score	Length	Source
Q9Y242	Transcription factor 19		PANTR		345	UniRef90_Q9Y242
Transcription factor 19		MACMU		345
TCF19		HUMAN		345
Uncharacterized protein		Cebus capucinus imitator		361
Transcription factor 19		CALJA		348
+26

Protein	Similar proteins		Species	Score	Length	Source
Q9Y242	Transcription factor 19		MACMU		345	UniRef50_Q9Y242
Transcription factor 19		PANTR		345
Transcription factor 19		PIG		346
TCF19		HUMAN		345
Uncharacterized protein		Cebus capucinus imitator		361
+120

Cross-referencesⁱ

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	S53374 mRNA Translation: AAB19475.2 Frameshift. AB029516 Genomic DNA Translation: BAA82324.1 AB029517 Genomic DNA Translation: BAA82325.1 AB029518 Genomic DNA Translation: BAA82326.1 AB029519 Genomic DNA Translation: BAA82327.1 U25826 Genomic DNA Translation: AAB60363.1 Frameshift. BA000025 Genomic DNA Translation: BAB63312.1 AB088113 Genomic DNA Translation: BAC54945.1 AB103619 Genomic DNA Translation: BAF31280.1 AB202105 Genomic DNA Translation: BAE78629.1 BT007247 mRNA Translation: AAP35911.1 AL662833 Genomic DNA No translation available. AL662844 Genomic DNA No translation available. AL773544 Genomic DNA No translation available. BX088580 Genomic DNA No translation available. CR759815 Genomic DNA No translation available. CR388229 Genomic DNA No translation available. CR753819 Genomic DNA No translation available. CR847794 Genomic DNA No translation available. CH471081 Genomic DNA Translation: EAX03363.1 BC002493 mRNA Translation: AAH02493.1 BC033086 mRNA Translation: AAH33086.1 BC044632 mRNA Translation: AAH44632.1
CCDSⁱ	CCDS43446.1
PIRⁱ	A61188
RefSeqⁱ	NP_001070979.1, NM_001077511.1 NP_001305837.1, NM_001318908.1 NP_009040.2, NM_007109.2
UniGeneⁱ	Hs.584807

3D structure databases

ProteinModelPortalⁱ	Q9Y242
SMRⁱ	Q9Y242
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protein-protein interaction databases

BioGridⁱ	112801, 13 interactors
IntActⁱ	Q9Y242, 16 interactors
MINTⁱ	Q9Y242
STRINGⁱ	9606.ENSP00000365431

PTM databases

iPTMnetⁱ	Q9Y242
PhosphoSitePlusⁱ	Q9Y242

Polymorphism and mutation databases

BioMutaⁱ	TCF19
DMDMⁱ	126302606

Proteomic databases

MaxQBⁱ	Q9Y242
PaxDbⁱ	Q9Y242
PeptideAtlasⁱ	Q9Y242
PRIDEⁱ	Q9Y242
ProteomicsDBⁱ	85640

Protocols and materials databases

The DNASU plasmid repository More...DNASUⁱ	6941
Structural Biology Knowledgebase	Search...

Genome annotation databases

Ensemblⁱ	ENST00000376255; ENSP00000365431; ENSG00000137310 ENST00000376257; ENSP00000365433; ENSG00000137310
GeneIDⁱ	6941
KEGGⁱ	hsa:6941
UCSCⁱ	uc003nss.4 human

Organism-specific databases

CTDⁱ	6941
DisGeNETⁱ	6941
EuPathDBⁱ	HostDB:ENSG00000137310.11
GeneCardsⁱ	TCF19
H-InvDBⁱ	HIX0005713
HGNCⁱ	HGNC:11629 TCF19
MIMⁱ	600912 gene
neXtProtⁱ	NX_Q9Y242
OpenTargetsⁱ	ENSG00000137310
PharmGKBⁱ	PA36384
GenAtlas: human gene database More...GenAtlasⁱ	Search...

Phylogenomic databases

eggNOGⁱ	ENOG410IXZZ Eukaryota ENOG4111J5W LUCA
GeneTreeⁱ	ENSGT00390000015391
HOVERGENⁱ	HBG054343
InParanoidⁱ	Q9Y242
OMAⁱ	ADFHCGC
OrthoDBⁱ	EOG091G05D2
PhylomeDBⁱ	Q9Y242
TreeFamⁱ	TF334697

Miscellaneous databases

ChiTaRSⁱ	TCF19 human
GeneWikiⁱ	TCF19
GenomeRNAiⁱ	6941
Protein Ontology More...PROⁱ	PR:Q9Y242
SOURCEⁱ	Search...

Gene expression databases

Bgeeⁱ	ENSG00000137310 Expressed in 130 organ(s), highest expression level in mucosa of transverse colon
ExpressionAtlasⁱ	Q9Y242 baseline and differential
Genevisibleⁱ	Q9Y242 HS

Family and domain databases

CDDⁱ	cd00060 FHA, 1 hit cd15609 PHD_TCF19, 1 hit
Gene3Dⁱ	3.30.40.10, 1 hit
InterProⁱ	View protein in InterPro IPR000253 FHA_dom IPR008984 SMAD_FHA_dom_sf IPR039095 TCF19_PHD IPR019786 Zinc_finger_PHD-type_CS IPR011011 Znf_FYVE_PHD IPR001965 Znf_PHD IPR013083 Znf_RING/FYVE/PHD
Pfamⁱ	View protein in Pfam PF00498 FHA, 1 hit
SMARTⁱ	View protein in SMART SM00240 FHA, 1 hit SM00249 PHD, 1 hit
SUPFAMⁱ	SSF49879 SSF49879, 1 hit SSF57903 SSF57903, 1 hit
PROSITEⁱ	View protein in PROSITE PS50006 FHA_DOMAIN, 1 hit PS01359 ZF_PHD_1, 1 hit
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	TCF19_HUMAN
Accessionⁱ	Q9Y242Primary (citable) accession number: Q9Y242 Secondary accession number(s): A6NCT8 Q9UBH7
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	February 16, 2004
	Last sequence update:	February 20, 2007
	Last modified:	November 7, 2018
	This is version 151 of the entry and version 2 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Chordata Protein Annotation Program
Disclaimer	Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousⁱ

Keywords - Technical termⁱ

Complete proteome, Reference proteome

Documents

Human entries with polymorphisms or disease mutations
List of human entries with polymorphisms or disease mutations
Human polymorphisms and disease mutations
Index of human polymorphisms and disease mutations
MIM cross-references
Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
Human chromosome 6
Human chromosome 6: entries, gene names and cross-references to MIM

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - Q9Y242 (TCF19_HUMAN)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

Transcription factor 19

TCF19

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Regions

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

Organism-specific databases

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Nucleus

Nucleus

Keywords - Cellular componenti

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Polymorphism and mutation databases

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Amino acid modifications

Keywords - PTMi

Proteomic databases

PTM databases

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Compositional bias

Zinc finger

Keywords - Domaini

Phylogenomic databases

Family and domain databases

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

Experimental Info

Natural variant

Sequence databases

Genome annotation databases

Keywords - Coding sequence diversityi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

3D structure databases

Protein-protein interaction databases

PTM databases

Polymorphism and mutation databases

Proteomic databases

Protocols and materials databases

Genome annotation databases

Organism-specific databases

Phylogenomic databases

Miscellaneous databases

Gene expression databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Documents

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

GO - Molecular functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

Keywords - Cellular componentⁱ

Pathology & Biotechⁱ

PTM / Processingⁱ

Keywords - PTMⁱ

Expressionⁱ

Interactionⁱ

Structureⁱ

Family & Domainsⁱ

Keywords - Domainⁱ

Sequence cautionⁱ

Keywords - Coding sequence diversityⁱ

Cross-referencesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ