Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 158 (31 Jul 2019)
Sequence version 1 (01 Nov 1999)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Cyclin-D-binding Myb-like transcription factor 1

Gene

DMTF1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Transcriptional activator which activates the CDKN2A/ARF locus in response to Ras-Raf signaling, thereby promoting p53/TP53-dependent growth arrest (By similarity). Binds to the consensus sequence 5'-CCCG[GT]ATGT-3' (By similarity). Isoform 1 may cooperate with MYB to activate transcription of the ANPEP gene. Isoform 2 may antagonize transcriptional activation by isoform 1.By similarity1 Publication

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section specifies the position and type of each DNA-binding domain present within the protein.<p><a href='/help/dna_bind' target='_top'>More...</a></p>DNA bindingi306 – 329H-T-H motifPROSITE-ProRule annotationAdd BLAST24

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActivator, DNA-binding
Biological processCell cycle, Transcription, Transcription regulation

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Cyclin-D-binding Myb-like transcription factor 1
Short name:
hDMTF1
Alternative name(s):
Cyclin-D-interacting Myb-like protein 1
Short name:
hDMP1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:DMTF1
Synonyms:DMP1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 7

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:14603 DMTF1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
608491 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9Y222

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Keywords - Diseasei

Tumor suppressor

Organism-specific databases

DisGeNET

More...
DisGeNETi
9988

Open Targets

More...
OpenTargetsi
ENSG00000135164

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA27389

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
DMTF1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
74762040

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003237291 – 760Cyclin-D-binding Myb-like transcription factor 1Add BLAST760

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated by the cyclin-D2/CDK4, cyclin-D3/CDK4 and cyclin-D2/CDK6 complexes and to a lesser extent by the cyclin-D1/CDK4 complex.By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9Y222

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9Y222

PeptideAtlas

More...
PeptideAtlasi
Q9Y222

PRoteomics IDEntifications database

More...
PRIDEi
Q9Y222

ProteomicsDB human proteome resource

More...
ProteomicsDBi
85599 [Q9Y222-1]
85600 [Q9Y222-2]
85601 [Q9Y222-3]
85602 [Q9Y222-4]
85603 [Q9Y222-5]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9Y222

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9Y222

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed at relatively low levels in colonic mucosa, ovary, peripheral leukocytes, prostate and small intestine, and at higher levels in spleen, testis and thymus. Expressed in multiple regions of the brain and CNS including amygdala, caudate, corpus callosum, hippocampus, substantia nigra and subthalamic nucleus. Isoform 1 is the predominant isoform in monocytes, macrophages and neutrophils, isoform 2 is most strongly expressed in peripheral blood leukocytes and quiescent CD34 positive cells, and isoform 3 is expressed at low levels in all hematopoietic cell types. Expression is frequently reduced in non-small-cell lung carcinomas (NSCLC) due to hemizygous gene deletion, strongly suggesting that this locus is haploinsufficient for tumor suppression. Loss of this locus frequently occurs in tumors which retain wild-type CDKN2A/ARF and p53/TP53 loci. Hemizygous gene deletion has also been observed in leukemic blasts from patients with abnormalities of the long arm of chromosome 7.3 Publications

<p>This subsection of the ‘Expression’ section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified ‘at the protein level’.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Isoform 2 expression is down-regulated during myeloid differentiation, while the expression of isoform 1 and isoform 3 remain constant.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000135164 Expressed in 235 organ(s), highest expression level in intestine

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9Y222 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9Y222 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA023846

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with the D-type cyclins CCND1, CCND2 and CCND3. Interaction with D-type cyclins may modulate transcriptional activation by this protein.

By similarity

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
115309, 4 interactors

Protein interaction database and analysis system

More...
IntActi
Q9Y222, 3 interactors

Molecular INTeraction database

More...
MINTi
Q9Y222

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000378193

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1760
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9Y222

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini225 – 263Myb-like 1PROSITE-ProRule annotationAdd BLAST39
Domaini268 – 333HTH myb-typePROSITE-ProRule annotationAdd BLAST66
Domaini339 – 388Myb-like 2PROSITE-ProRule annotationAdd BLAST50

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 237Interaction with CCND2By similarityAdd BLAST237
Regioni87 – 458Required for DNA-bindingBy similarityAdd BLAST372
Regioni87 – 170Required for transcriptional activationBy similarityAdd BLAST84
Regioni176 – 760Interaction with CCND1, CCND2 and CCND3By similarityAdd BLAST585
Regioni459 – 760Required for transcriptional activationBy similarityAdd BLAST302

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the DMTF1 family.Curated

Keywords - Domaini

Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0051 Eukaryota
COG5147 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000156016

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9Y222

KEGG Orthology (KO)

More...
KOi
K21625

Identification of Orthologs from Complete Genome Data

More...
OMAi
HQPKMTV

Database of Orthologous Groups

More...
OrthoDBi
1474117at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9Y222

TreeFam database of animal gene trees

More...
TreeFami
TF333537

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00167 SANT, 3 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR009057 Homeobox-like_sf
IPR017877 Myb-like_dom
IPR017930 Myb_dom
IPR001005 SANT/Myb

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00249 Myb_DNA-binding, 2 hits

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00717 SANT, 3 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF46689 SSF46689, 3 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51294 HTH_MYB, 1 hit
PS50090 MYB_LIKE, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 18 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9Y222-1) [UniParc]FASTAAdd to basket
Also known as: Alpha

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSTVEEDSDT VTVETVNSVT LTQDTEGNLI LHCPQNEADE IDSEDSIEPP
60 70 80 90 100
HKRLCLSSED DQSIDDSTPC ISVVALPLSE NDQSFEVTMT ATTEVADDEV
110 120 130 140 150
TEGTVTQIQI LQNEQLDEIS PLGNEEVSAV SQAWFTTKED KDSLTNKGHK
160 170 180 190 200
WKQGMWSKEE IDILMNNIER YLKARGIKDA TEIIFEMSKD ERKDFYRTIA
210 220 230 240 250
WGLNRPLFAV YRRVLRMYDD RNHVGKYTPE EIEKLKELRI KHGNDWATIG
260 270 280 290 300
AALGRSASSV KDRCRLMKDT CNTGKWTEEE EKRLAEVVHE LTSTEPGDIV
310 320 330 340 350
TQGVSWAAVA ERVGTRSEKQ CRSKWLNYLN WKQSGGTEWT KEDEINLILR
360 370 380 390 400
IAELDVADEN DINWDLLAEG WSSVRSPQWL RSKWWTIKRQ IANHKDVSFP
410 420 430 440 450
VLIKGLKQLH ENQKNNPTLL ENKSGSGVPN SNTNSSVQHV QIRVARLEDN
460 470 480 490 500
TAISSSPMAA LQIPVQITHV SSADSPATVD SETITLNSGT LQTFEILPSF
510 520 530 540 550
HLQPTGTPGT YLLQTSSSQG LPLTLTASPT VTLTAAAPAS PEQIIVHALS
560 570 580 590 600
PEHLLNTSDN VTVQCHTPRV IIQTVATEDI TSSISQAELT VDSDIQSSDF
610 620 630 640 650
PEPPDALEAD TFPDEIHHPK MTVEPSFNDA HVSKFSDQNS TELMNSVMVR
660 670 680 690 700
TEEEISDTDL KQEESPSDLA SAYVTEGLES PTIEEQVDQT IDDETILIVP
710 720 730 740 750
SPHGFIQASD VIDTESVLPL TTLTDPILQH HQEESNIIGS SLGSPVSEDS
760
KDVEDLVNCH
Length:760
Mass (Da):84,471
Last modified:November 1, 1999 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i57B3AE332F21A333
GO
Isoform 2 (identifier: Q9Y222-2) [UniParc]FASTAAdd to basket
Also known as: Beta

The sequence of this isoform differs from the canonical sequence as follows:
     238-273: LRIKHGNDWATIGAALGRSASSVKDRCRLMKDTCNT → QLWTPKKGHTFKLWLSKYCCPQLPNQSNGKKKNEE
     274-760: Missing.

Show »
Length:272
Mass (Da):31,227
Checksum:i0D3F2715231DAED9
GO
Isoform 3 (identifier: Q9Y222-3) [UniParc]FASTAAdd to basket
Also known as: Gamma

The sequence of this isoform differs from the canonical sequence as follows:
     238-285: LRIKHGNDWA...WTEEEEKRLA → KKAIAACFFF...QSNGKKKNEE
     286-760: Missing.

Show »
Length:285
Mass (Da):32,749
Checksum:i0DBCC4F2345C48BF
GO
Isoform 4 (identifier: Q9Y222-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     37-78: EADEIDSEDSIEPPHKRLCLSSEDDQSIDDSTPCISVVALPL → V
     238-285: LRIKHGNDWA...WTEEEEKRLA → KKAIAACFFF...QSNGKKKNEE
     286-760: Missing.

Show »
Length:244
Mass (Da):28,296
Checksum:i59F912F2CC8082E7
GO
Isoform 5 (identifier: Q9Y222-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-88: Missing.

Show »
Length:672
Mass (Da):74,878
Checksum:i818B4CFA4326350C
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 18 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E7EPA0E7EPA0_HUMAN
Cyclin-D-binding Myb-like transcrip...
DMTF1
690Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C388H7C388_HUMAN
Cyclin-D-binding Myb-like transcrip...
DMTF1
176Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3QKU5J3QKU5_HUMAN
Cyclin-D-binding Myb-like transcrip...
DMTF1
178Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JED5C9JED5_HUMAN
Cyclin-D-binding Myb-like transcrip...
DMTF1
73Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8VXY9F8VXY9_HUMAN
Cyclin-D-binding Myb-like transcrip...
DMTF1
378Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3QLN9J3QLN9_HUMAN
Cyclin-D-binding Myb-like transcrip...
DMTF1
365Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9K0K9C9K0K9_HUMAN
Cyclin-D-binding Myb-like transcrip...
DMTF1
27Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JGT5C9JGT5_HUMAN
Cyclin-D-binding Myb-like transcrip...
DMTF1
175Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JFR2C9JFR2_HUMAN
Cyclin-D-binding Myb-like transcrip...
DMTF1
191Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9K0L9C9K0L9_HUMAN
Cyclin-D-binding Myb-like transcrip...
DMTF1
85Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There are more potential isoformsShow all

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAD92467 differs from that shown. Reason: Erroneous translation. Wrong choice of frame.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti345I → T in BAG58937 (PubMed:14702039).Curated1
Sequence conflicti616I → V in AAH70064 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_039577479V → I. Corresponds to variant dbSNP:rs1558049Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0410631 – 88Missing in isoform 5. 1 PublicationAdd BLAST88
Alternative sequenceiVSP_03208937 – 78EADEI…VALPL → V in isoform 4. 1 PublicationAdd BLAST42
Alternative sequenceiVSP_032090238 – 285LRIKH…EKRLA → KKAIAACFFFTHRQLWTPKK GHTFKLWLSKYCCPQLPNQS NGKKKNEE in isoform 3 and isoform 4. 2 PublicationsAdd BLAST48
Alternative sequenceiVSP_032091238 – 273LRIKH…DTCNT → QLWTPKKGHTFKLWLSKYCC PQLPNQSNGKKKNEE in isoform 2. 2 PublicationsAdd BLAST36
Alternative sequenceiVSP_032092274 – 760Missing in isoform 2. 2 PublicationsAdd BLAST487
Alternative sequenceiVSP_032093286 – 760Missing in isoform 3 and isoform 4. 2 PublicationsAdd BLAST475

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF084530 mRNA Translation: AAC33480.1
AF202144 mRNA Translation: AAG35613.1
AF202145 mRNA Translation: AAG35614.1
AK296211 mRNA Translation: BAG58937.1
AK126664 mRNA No translation available.
AK314622 mRNA Translation: BAG37188.1
AB209230 mRNA Translation: BAD92467.1 Sequence problems.
AC005076 Genomic DNA Translation: AAD43181.1
CH471091 Genomic DNA Translation: EAW76963.1
BC007418 mRNA Translation: AAH07418.2
BC007447 mRNA Translation: AAH07447.2
BC029370 mRNA Translation: AAH29370.1 Different termination.
BC070064 mRNA Translation: AAH70064.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS47633.1 [Q9Y222-5]
CCDS5601.1 [Q9Y222-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001135798.1, NM_001142326.1 [Q9Y222-5]
NP_001135799.1, NM_001142327.1 [Q9Y222-1]
NP_066968.3, NM_021145.3 [Q9Y222-1]
XP_011515037.1, XM_011516735.2 [Q9Y222-1]
XP_011515039.1, XM_011516737.1 [Q9Y222-1]
XP_016868354.1, XM_017012865.1 [Q9Y222-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000331242; ENSP00000332171; ENSG00000135164 [Q9Y222-1]
ENST00000394703; ENSP00000378193; ENSG00000135164 [Q9Y222-1]
ENST00000412139; ENSP00000407941; ENSG00000135164 [Q9Y222-2]
ENST00000425406; ENSP00000411908; ENSG00000135164 [Q9Y222-4]
ENST00000432937; ENSP00000412532; ENSG00000135164 [Q9Y222-5]
ENST00000447863; ENSP00000389774; ENSG00000135164 [Q9Y222-3]
ENST00000579677; ENSP00000464596; ENSG00000135164 [Q9Y222-2]
ENST00000584619; ENSP00000464092; ENSG00000135164 [Q9Y222-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
9988

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:9988

UCSC genome browser

More...
UCSCi
uc003uih.3 human [Q9Y222-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF084530 mRNA Translation: AAC33480.1
AF202144 mRNA Translation: AAG35613.1
AF202145 mRNA Translation: AAG35614.1
AK296211 mRNA Translation: BAG58937.1
AK126664 mRNA No translation available.
AK314622 mRNA Translation: BAG37188.1
AB209230 mRNA Translation: BAD92467.1 Sequence problems.
AC005076 Genomic DNA Translation: AAD43181.1
CH471091 Genomic DNA Translation: EAW76963.1
BC007418 mRNA Translation: AAH07418.2
BC007447 mRNA Translation: AAH07447.2
BC029370 mRNA Translation: AAH29370.1 Different termination.
BC070064 mRNA Translation: AAH70064.1
CCDSiCCDS47633.1 [Q9Y222-5]
CCDS5601.1 [Q9Y222-1]
RefSeqiNP_001135798.1, NM_001142326.1 [Q9Y222-5]
NP_001135799.1, NM_001142327.1 [Q9Y222-1]
NP_066968.3, NM_021145.3 [Q9Y222-1]
XP_011515037.1, XM_011516735.2 [Q9Y222-1]
XP_011515039.1, XM_011516737.1 [Q9Y222-1]
XP_016868354.1, XM_017012865.1 [Q9Y222-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2LLKNMR-A220-274[»]
SMRiQ9Y222
ModBaseiSearch...

Protein-protein interaction databases

BioGridi115309, 4 interactors
IntActiQ9Y222, 3 interactors
MINTiQ9Y222
STRINGi9606.ENSP00000378193

PTM databases

iPTMnetiQ9Y222
PhosphoSitePlusiQ9Y222

Polymorphism and mutation databases

BioMutaiDMTF1
DMDMi74762040

Proteomic databases

jPOSTiQ9Y222
PaxDbiQ9Y222
PeptideAtlasiQ9Y222
PRIDEiQ9Y222
ProteomicsDBi85599 [Q9Y222-1]
85600 [Q9Y222-2]
85601 [Q9Y222-3]
85602 [Q9Y222-4]
85603 [Q9Y222-5]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000331242; ENSP00000332171; ENSG00000135164 [Q9Y222-1]
ENST00000394703; ENSP00000378193; ENSG00000135164 [Q9Y222-1]
ENST00000412139; ENSP00000407941; ENSG00000135164 [Q9Y222-2]
ENST00000425406; ENSP00000411908; ENSG00000135164 [Q9Y222-4]
ENST00000432937; ENSP00000412532; ENSG00000135164 [Q9Y222-5]
ENST00000447863; ENSP00000389774; ENSG00000135164 [Q9Y222-3]
ENST00000579677; ENSP00000464596; ENSG00000135164 [Q9Y222-2]
ENST00000584619; ENSP00000464092; ENSG00000135164 [Q9Y222-2]
GeneIDi9988
KEGGihsa:9988
UCSCiuc003uih.3 human [Q9Y222-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
9988
DisGeNETi9988

GeneCards: human genes, protein and diseases

More...
GeneCardsi
DMTF1
HGNCiHGNC:14603 DMTF1
HPAiHPA023846
MIMi608491 gene
neXtProtiNX_Q9Y222
OpenTargetsiENSG00000135164
PharmGKBiPA27389

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0051 Eukaryota
COG5147 LUCA
GeneTreeiENSGT00940000156016
InParanoidiQ9Y222
KOiK21625
OMAiHQPKMTV
OrthoDBi1474117at2759
PhylomeDBiQ9Y222
TreeFamiTF333537

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
DMTF1 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
DMTF1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
9988

Protein Ontology

More...
PROi
PR:Q9Y222

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000135164 Expressed in 235 organ(s), highest expression level in intestine
ExpressionAtlasiQ9Y222 baseline and differential
GenevisibleiQ9Y222 HS

Family and domain databases

CDDicd00167 SANT, 3 hits
InterProiView protein in InterPro
IPR009057 Homeobox-like_sf
IPR017877 Myb-like_dom
IPR017930 Myb_dom
IPR001005 SANT/Myb
PfamiView protein in Pfam
PF00249 Myb_DNA-binding, 2 hits
SMARTiView protein in SMART
SM00717 SANT, 3 hits
SUPFAMiSSF46689 SSF46689, 3 hits
PROSITEiView protein in PROSITE
PS51294 HTH_MYB, 1 hit
PS50090 MYB_LIKE, 2 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiDMTF1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9Y222
Secondary accession number(s): B2RBE1
, B4DJS5, Q05C48, Q59G79, Q6IS13, Q969T2, Q9H2Z2, Q9H2Z3
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 18, 2008
Last sequence update: November 1, 1999
Last modified: July 31, 2019
This is version 158 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again