Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Cyclin-D-binding Myb-like transcription factor 1

Gene

DMTF1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Transcriptional activator which activates the CDKN2A/ARF locus in response to Ras-Raf signaling, thereby promoting p53/TP53-dependent growth arrest (By similarity). Binds to the consensus sequence 5'-CCCG[GT]ATGT-3' (By similarity). Isoform 1 may cooperate with MYB to activate transcription of the ANPEP gene. Isoform 2 may antagonize transcriptional activation by isoform 1.By similarity1 Publication

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
DNA bindingi306 – 329H-T-H motifPROSITE-ProRule annotationAdd BLAST24

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionActivator, DNA-binding
Biological processCell cycle, Transcription, Transcription regulation

Names & Taxonomyi

Protein namesi
Recommended name:
Cyclin-D-binding Myb-like transcription factor 1
Short name:
hDMTF1
Alternative name(s):
Cyclin-D-interacting Myb-like protein 1
Short name:
hDMP1
Gene namesi
Name:DMTF1
Synonyms:DMP1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 7

Organism-specific databases

EuPathDBiHostDB:ENSG00000135164.18
HGNCiHGNC:14603 DMTF1
MIMi608491 gene
neXtProtiNX_Q9Y222

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Keywords - Diseasei

Tumor suppressor

Organism-specific databases

DisGeNETi9988
OpenTargetsiENSG00000135164
PharmGKBiPA27389

Polymorphism and mutation databases

BioMutaiDMTF1
DMDMi74762040

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003237291 – 760Cyclin-D-binding Myb-like transcription factor 1Add BLAST760

Post-translational modificationi

Phosphorylated by the cyclin-D2/CDK4, cyclin-D3/CDK4 and cyclin-D2/CDK6 complexes and to a lesser extent by the cyclin-D1/CDK4 complex.By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ9Y222
PaxDbiQ9Y222
PeptideAtlasiQ9Y222
PRIDEiQ9Y222
ProteomicsDBi85599
85600 [Q9Y222-2]
85601 [Q9Y222-3]
85602 [Q9Y222-4]
85603 [Q9Y222-5]

PTM databases

iPTMnetiQ9Y222
PhosphoSitePlusiQ9Y222

Expressioni

Tissue specificityi

Expressed at relatively low levels in colonic mucosa, ovary, peripheral leukocytes, prostate and small intestine, and at higher levels in spleen, testis and thymus. Expressed in multiple regions of the brain and CNS including amygdala, caudate, corpus callosum, hippocampus, substantia nigra and subthalamic nucleus. Isoform 1 is the predominant isoform in monocytes, macrophages and neutrophils, isoform 2 is most strongly expressed in peripheral blood leukocytes and quiescent CD34 positive cells, and isoform 3 is expressed at low levels in all hematopoietic cell types. Expression is frequently reduced in non-small-cell lung carcinomas (NSCLC) due to hemizygous gene deletion, strongly suggesting that this locus is haploinsufficient for tumor suppression. Loss of this locus frequently occurs in tumors which retain wild-type CDKN2A/ARF and p53/TP53 loci. Hemizygous gene deletion has also been observed in leukemic blasts from patients with abnormalities of the long arm of chromosome 7.3 Publications

Developmental stagei

Isoform 2 expression is down-regulated during myeloid differentiation, while the expression of isoform 1 and isoform 3 remain constant.

Gene expression databases

BgeeiENSG00000135164 Expressed in 235 organ(s), highest expression level in intestine
CleanExiHS_DMP1
HS_DMTF1
ExpressionAtlasiQ9Y222 baseline and differential
GenevisibleiQ9Y222 HS

Organism-specific databases

HPAiHPA023846

Interactioni

Subunit structurei

Interacts with the D-type cyclins CCND1, CCND2 and CCND3. Interaction with D-type cyclins may modulate transcriptional activation by this protein.By similarity

Protein-protein interaction databases

BioGridi115309, 4 interactors
IntActiQ9Y222, 3 interactors
MINTiQ9Y222
STRINGi9606.ENSP00000332171

Structurei

Secondary structure

1760
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliQ9Y222
SMRiQ9Y222
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini225 – 263Myb-like 1PROSITE-ProRule annotationAdd BLAST39
Domaini268 – 333HTH myb-typePROSITE-ProRule annotationAdd BLAST66
Domaini339 – 388Myb-like 2PROSITE-ProRule annotationAdd BLAST50

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni1 – 237Interaction with CCND2By similarityAdd BLAST237
Regioni87 – 458Required for DNA-bindingBy similarityAdd BLAST372
Regioni87 – 170Required for transcriptional activationBy similarityAdd BLAST84
Regioni176 – 760Interaction with CCND1, CCND2 and CCND3By similarityAdd BLAST585
Regioni459 – 760Required for transcriptional activationBy similarityAdd BLAST302

Sequence similaritiesi

Belongs to the DMTF1 family.Curated

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG0051 Eukaryota
COG5147 LUCA
GeneTreeiENSGT00530000063659
HOVERGENiHBG053416
InParanoidiQ9Y222
KOiK21625
OMAiFPDEIHQ
OrthoDBiEOG091G03T9
PhylomeDBiQ9Y222
TreeFamiTF333537

Family and domain databases

CDDicd00167 SANT, 3 hits
InterProiView protein in InterPro
IPR009057 Homeobox-like_sf
IPR017877 Myb-like_dom
IPR017930 Myb_dom
IPR001005 SANT/Myb
PfamiView protein in Pfam
PF00249 Myb_DNA-binding, 2 hits
SMARTiView protein in SMART
SM00717 SANT, 3 hits
SUPFAMiSSF46689 SSF46689, 3 hits
PROSITEiView protein in PROSITE
PS51294 HTH_MYB, 1 hit
PS50090 MYB_LIKE, 2 hits

Sequences (5+)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 18 potential isoforms that are computationally mapped.iShow all

Isoform 1 (identifier: Q9Y222-1) [UniParc]FASTAAdd to basket
Also known as: Alpha

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSTVEEDSDT VTVETVNSVT LTQDTEGNLI LHCPQNEADE IDSEDSIEPP
60 70 80 90 100
HKRLCLSSED DQSIDDSTPC ISVVALPLSE NDQSFEVTMT ATTEVADDEV
110 120 130 140 150
TEGTVTQIQI LQNEQLDEIS PLGNEEVSAV SQAWFTTKED KDSLTNKGHK
160 170 180 190 200
WKQGMWSKEE IDILMNNIER YLKARGIKDA TEIIFEMSKD ERKDFYRTIA
210 220 230 240 250
WGLNRPLFAV YRRVLRMYDD RNHVGKYTPE EIEKLKELRI KHGNDWATIG
260 270 280 290 300
AALGRSASSV KDRCRLMKDT CNTGKWTEEE EKRLAEVVHE LTSTEPGDIV
310 320 330 340 350
TQGVSWAAVA ERVGTRSEKQ CRSKWLNYLN WKQSGGTEWT KEDEINLILR
360 370 380 390 400
IAELDVADEN DINWDLLAEG WSSVRSPQWL RSKWWTIKRQ IANHKDVSFP
410 420 430 440 450
VLIKGLKQLH ENQKNNPTLL ENKSGSGVPN SNTNSSVQHV QIRVARLEDN
460 470 480 490 500
TAISSSPMAA LQIPVQITHV SSADSPATVD SETITLNSGT LQTFEILPSF
510 520 530 540 550
HLQPTGTPGT YLLQTSSSQG LPLTLTASPT VTLTAAAPAS PEQIIVHALS
560 570 580 590 600
PEHLLNTSDN VTVQCHTPRV IIQTVATEDI TSSISQAELT VDSDIQSSDF
610 620 630 640 650
PEPPDALEAD TFPDEIHHPK MTVEPSFNDA HVSKFSDQNS TELMNSVMVR
660 670 680 690 700
TEEEISDTDL KQEESPSDLA SAYVTEGLES PTIEEQVDQT IDDETILIVP
710 720 730 740 750
SPHGFIQASD VIDTESVLPL TTLTDPILQH HQEESNIIGS SLGSPVSEDS
760
KDVEDLVNCH
Length:760
Mass (Da):84,471
Last modified:November 1, 1999 - v1
Checksum:i57B3AE332F21A333
GO
Isoform 2 (identifier: Q9Y222-2) [UniParc]FASTAAdd to basket
Also known as: Beta

The sequence of this isoform differs from the canonical sequence as follows:
     238-273: LRIKHGNDWATIGAALGRSASSVKDRCRLMKDTCNT → QLWTPKKGHTFKLWLSKYCCPQLPNQSNGKKKNEE
     274-760: Missing.

Show »
Length:272
Mass (Da):31,227
Checksum:i0D3F2715231DAED9
GO
Isoform 3 (identifier: Q9Y222-3) [UniParc]FASTAAdd to basket
Also known as: Gamma

The sequence of this isoform differs from the canonical sequence as follows:
     238-285: LRIKHGNDWA...WTEEEEKRLA → KKAIAACFFF...QSNGKKKNEE
     286-760: Missing.

Show »
Length:285
Mass (Da):32,749
Checksum:i0DBCC4F2345C48BF
GO
Isoform 4 (identifier: Q9Y222-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     37-78: EADEIDSEDSIEPPHKRLCLSSEDDQSIDDSTPCISVVALPL → V
     238-285: LRIKHGNDWA...WTEEEEKRLA → KKAIAACFFF...QSNGKKKNEE
     286-760: Missing.

Show »
Length:244
Mass (Da):28,296
Checksum:i59F912F2CC8082E7
GO
Isoform 5 (identifier: Q9Y222-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-88: Missing.

Show »
Length:672
Mass (Da):74,878
Checksum:i818B4CFA4326350C
GO

Computationally mapped potential isoform sequencesi

There are 18 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E7EPA0E7EPA0_HUMAN
Cyclin-D-binding Myb-like transcrip...
DMTF1
690Annotation score:
H7C388H7C388_HUMAN
Cyclin-D-binding Myb-like transcrip...
DMTF1
176Annotation score:
J3QKU5J3QKU5_HUMAN
Cyclin-D-binding Myb-like transcrip...
DMTF1
178Annotation score:
F8VXY9F8VXY9_HUMAN
Cyclin-D-binding Myb-like transcrip...
DMTF1
378Annotation score:
J3QLN9J3QLN9_HUMAN
Cyclin-D-binding Myb-like transcrip...
DMTF1
365Annotation score:
C9JFR2C9JFR2_HUMAN
Cyclin-D-binding Myb-like transcrip...
DMTF1
191Annotation score:
C9JGT5C9JGT5_HUMAN
Cyclin-D-binding Myb-like transcrip...
DMTF1
175Annotation score:
C9JVQ7C9JVQ7_HUMAN
Cyclin-D-binding Myb-like transcrip...
DMTF1
96Annotation score:
C9JED5C9JED5_HUMAN
Cyclin-D-binding Myb-like transcrip...
DMTF1
73Annotation score:
J3KRC1J3KRC1_HUMAN
Cyclin-D-binding Myb-like transcrip...
DMTF1
34Annotation score:
There are more potential isoformsShow all

Sequence cautioni

The sequence BAD92467 differs from that shown. Reason: Erroneous translation. Wrong choice of frame.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti345I → T in BAG58937 (PubMed:14702039).Curated1
Sequence conflicti616I → V in AAH70064 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_039577479V → I. Corresponds to variant dbSNP:rs1558049Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0410631 – 88Missing in isoform 5. 1 PublicationAdd BLAST88
Alternative sequenceiVSP_03208937 – 78EADEI…VALPL → V in isoform 4. 1 PublicationAdd BLAST42
Alternative sequenceiVSP_032090238 – 285LRIKH…EKRLA → KKAIAACFFFTHRQLWTPKK GHTFKLWLSKYCCPQLPNQS NGKKKNEE in isoform 3 and isoform 4. 2 PublicationsAdd BLAST48
Alternative sequenceiVSP_032091238 – 273LRIKH…DTCNT → QLWTPKKGHTFKLWLSKYCC PQLPNQSNGKKKNEE in isoform 2. 2 PublicationsAdd BLAST36
Alternative sequenceiVSP_032092274 – 760Missing in isoform 2. 2 PublicationsAdd BLAST487
Alternative sequenceiVSP_032093286 – 760Missing in isoform 3 and isoform 4. 2 PublicationsAdd BLAST475

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF084530 mRNA Translation: AAC33480.1
AF202144 mRNA Translation: AAG35613.1
AF202145 mRNA Translation: AAG35614.1
AK296211 mRNA Translation: BAG58937.1
AK126664 mRNA No translation available.
AK314622 mRNA Translation: BAG37188.1
AB209230 mRNA Translation: BAD92467.1 Sequence problems.
AC005076 Genomic DNA Translation: AAD43181.1
CH471091 Genomic DNA Translation: EAW76963.1
BC007418 mRNA Translation: AAH07418.2
BC007447 mRNA Translation: AAH07447.2
BC029370 mRNA Translation: AAH29370.1 Different termination.
BC070064 mRNA Translation: AAH70064.1
CCDSiCCDS47633.1 [Q9Y222-5]
CCDS5601.1 [Q9Y222-1]
RefSeqiNP_001135798.1, NM_001142326.1 [Q9Y222-5]
NP_001135799.1, NM_001142327.1 [Q9Y222-1]
NP_066968.3, NM_021145.3 [Q9Y222-1]
XP_011515037.1, XM_011516735.2 [Q9Y222-1]
XP_011515039.1, XM_011516737.1 [Q9Y222-1]
XP_016868354.1, XM_017012865.1 [Q9Y222-1]
UniGeneiHs.196129

Genome annotation databases

EnsembliENST00000331242; ENSP00000332171; ENSG00000135164 [Q9Y222-1]
ENST00000394703; ENSP00000378193; ENSG00000135164 [Q9Y222-1]
ENST00000412139; ENSP00000407941; ENSG00000135164 [Q9Y222-2]
ENST00000425406; ENSP00000411908; ENSG00000135164 [Q9Y222-4]
ENST00000432937; ENSP00000412532; ENSG00000135164 [Q9Y222-5]
ENST00000447863; ENSP00000389774; ENSG00000135164 [Q9Y222-3]
ENST00000579677; ENSP00000464596; ENSG00000135164 [Q9Y222-2]
ENST00000584619; ENSP00000464092; ENSG00000135164 [Q9Y222-2]
GeneIDi9988
KEGGihsa:9988
UCSCiuc003uih.3 human [Q9Y222-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF084530 mRNA Translation: AAC33480.1
AF202144 mRNA Translation: AAG35613.1
AF202145 mRNA Translation: AAG35614.1
AK296211 mRNA Translation: BAG58937.1
AK126664 mRNA No translation available.
AK314622 mRNA Translation: BAG37188.1
AB209230 mRNA Translation: BAD92467.1 Sequence problems.
AC005076 Genomic DNA Translation: AAD43181.1
CH471091 Genomic DNA Translation: EAW76963.1
BC007418 mRNA Translation: AAH07418.2
BC007447 mRNA Translation: AAH07447.2
BC029370 mRNA Translation: AAH29370.1 Different termination.
BC070064 mRNA Translation: AAH70064.1
CCDSiCCDS47633.1 [Q9Y222-5]
CCDS5601.1 [Q9Y222-1]
RefSeqiNP_001135798.1, NM_001142326.1 [Q9Y222-5]
NP_001135799.1, NM_001142327.1 [Q9Y222-1]
NP_066968.3, NM_021145.3 [Q9Y222-1]
XP_011515037.1, XM_011516735.2 [Q9Y222-1]
XP_011515039.1, XM_011516737.1 [Q9Y222-1]
XP_016868354.1, XM_017012865.1 [Q9Y222-1]
UniGeneiHs.196129

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2LLKNMR-A220-274[»]
ProteinModelPortaliQ9Y222
SMRiQ9Y222
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi115309, 4 interactors
IntActiQ9Y222, 3 interactors
MINTiQ9Y222
STRINGi9606.ENSP00000332171

PTM databases

iPTMnetiQ9Y222
PhosphoSitePlusiQ9Y222

Polymorphism and mutation databases

BioMutaiDMTF1
DMDMi74762040

Proteomic databases

EPDiQ9Y222
PaxDbiQ9Y222
PeptideAtlasiQ9Y222
PRIDEiQ9Y222
ProteomicsDBi85599
85600 [Q9Y222-2]
85601 [Q9Y222-3]
85602 [Q9Y222-4]
85603 [Q9Y222-5]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000331242; ENSP00000332171; ENSG00000135164 [Q9Y222-1]
ENST00000394703; ENSP00000378193; ENSG00000135164 [Q9Y222-1]
ENST00000412139; ENSP00000407941; ENSG00000135164 [Q9Y222-2]
ENST00000425406; ENSP00000411908; ENSG00000135164 [Q9Y222-4]
ENST00000432937; ENSP00000412532; ENSG00000135164 [Q9Y222-5]
ENST00000447863; ENSP00000389774; ENSG00000135164 [Q9Y222-3]
ENST00000579677; ENSP00000464596; ENSG00000135164 [Q9Y222-2]
ENST00000584619; ENSP00000464092; ENSG00000135164 [Q9Y222-2]
GeneIDi9988
KEGGihsa:9988
UCSCiuc003uih.3 human [Q9Y222-1]

Organism-specific databases

CTDi9988
DisGeNETi9988
EuPathDBiHostDB:ENSG00000135164.18
GeneCardsiDMTF1
H-InvDBiHIX0006815
HGNCiHGNC:14603 DMTF1
HPAiHPA023846
MIMi608491 gene
neXtProtiNX_Q9Y222
OpenTargetsiENSG00000135164
PharmGKBiPA27389
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0051 Eukaryota
COG5147 LUCA
GeneTreeiENSGT00530000063659
HOVERGENiHBG053416
InParanoidiQ9Y222
KOiK21625
OMAiFPDEIHQ
OrthoDBiEOG091G03T9
PhylomeDBiQ9Y222
TreeFamiTF333537

Miscellaneous databases

ChiTaRSiDMTF1 human
GeneWikiiDMTF1
GenomeRNAii9988
PROiPR:Q9Y222
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000135164 Expressed in 235 organ(s), highest expression level in intestine
CleanExiHS_DMP1
HS_DMTF1
ExpressionAtlasiQ9Y222 baseline and differential
GenevisibleiQ9Y222 HS

Family and domain databases

CDDicd00167 SANT, 3 hits
InterProiView protein in InterPro
IPR009057 Homeobox-like_sf
IPR017877 Myb-like_dom
IPR017930 Myb_dom
IPR001005 SANT/Myb
PfamiView protein in Pfam
PF00249 Myb_DNA-binding, 2 hits
SMARTiView protein in SMART
SM00717 SANT, 3 hits
SUPFAMiSSF46689 SSF46689, 3 hits
PROSITEiView protein in PROSITE
PS51294 HTH_MYB, 1 hit
PS50090 MYB_LIKE, 2 hits
ProtoNetiSearch...

Entry informationi

Entry nameiDMTF1_HUMAN
AccessioniPrimary (citable) accession number: Q9Y222
Secondary accession number(s): B2RBE1
, B4DJS5, Q05C48, Q59G79, Q6IS13, Q969T2, Q9H2Z2, Q9H2Z3
Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 18, 2008
Last sequence update: November 1, 1999
Last modified: September 12, 2018
This is version 149 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again