Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 140 (07 Apr 2021)
Sequence version 1 (01 Nov 1999)
Previous versions | rss
Add a publicationFeedback
Protein

V-type proton ATPase subunit C

Gene

vha-11

Organism
Caenorhabditis elegans
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Subunit of the peripheral V1 complex of vacuolar ATPase. Subunit C is necessary for the assembly of the catalytic sector of the enzyme and is likely to have a specific function in its catalytic activity. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells. Has roles in embryogenesis and ovulation.2 Publications

Miscellaneous

Vha-11 and vha-3 are transcribed on a dicistronic transcript where vha-3 is the upstream transcript and vha-11 the downstream.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

  • embryo development ending in birth or egg hatching Source: UniProtKB
  • ovulation Source: UniProtKB

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDevelopmental protein
Biological processHydrogen ion transport, Ion transport, Transport

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-CEL-1222556, ROS and RNS production in phagocytes
R-CEL-77387, Insulin receptor recycling
R-CEL-917977, Transferrin endocytosis and recycling
R-CEL-9639288, Amino acids regulate mTORC1
R-CEL-983712, Ion channel transport

Protein family/group databases

Transport Classification Database

More...
TCDBi
3.A.2.2.7, the h(+)- or na(+)-translocating f-type, v-type and a-type atpase (f-atpase) superfamily

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
V-type proton ATPase subunit C
Short name:
V-ATPase subunit C
Alternative name(s):
Vacuolar proton pump subunit C
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:vha-11
ORF Names:Y38F2AL.3
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiCaenorhabditis elegans
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri6239 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaEcdysozoaNematodaChromadoreaRhabditidaRhabditinaRhabditomorphaRhabditoideaRhabditidaePeloderinaeCaenorhabditis
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000001940 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome IV

Organism-specific databases

WormBase

More...
WormBasei
Y38F2AL.3a ; CE29997 ; WBGene00006920 ; vha-11
Y38F2AL.3b ; CE38743 ; WBGene00006920 ; vha-11

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cytoplasm

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

Worms display embryonic lethality. When vha-11 is silenced in adults, they are able to produce eggs but egg numbers gradually decrease and worms become sterile after 24 hours. This sterility continues for about 4 days and then viable eggs are produced again.1 Publication

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002093511 – 384V-type proton ATPase subunit CAdd BLAST384

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9XXU9

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9XXU9

PeptideAtlas

More...
PeptideAtlasi
Q9XXU9

PRoteomics IDEntifications database

More...
PRIDEi
Q9XXU9

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed ubiquitously; higher levels are found in gastrointestinal and hypodermal cells, as well as H-shaped excretory cell.2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
WBGene00006920, Expressed in material anatomical entity and 5 other tissues

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

V-ATPase is a heteromultimeric enzyme composed of a peripheral catalytic V1 complex (components A to H) attached to an integral membrane V0 proton pore complex (components: a, c, c', c'' and d).

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
42169, 21 interactors

STRING: functional protein association networks

More...
STRINGi
6239.Y38F2AL.3a

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9XXU9

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the V-ATPase C subunit family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2909, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000004263

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_017554_3_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9XXU9

Identification of Orthologs from Complete Genome Data

More...
OMAi
ETHLIVV

Database of Orthologous Groups

More...
OrthoDBi
1016088at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9XXU9

Family and domain databases

Conserved Domains Database

More...
CDDi
cd14785, V-ATPase_C, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR004907, ATPase_V1-cplx_csu
IPR036132, Vac_ATP_synth_c_sf

The PANTHER Classification System

More...
PANTHERi
PTHR10137, PTHR10137, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF03223, V-ATPase_C, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF118203, SSF118203, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform a (identifier: Q9XXU9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSSATSGEYW LISVPGEKGA NDAWDKLNRS TGNTSTNSKY LIPDLKVGTL
60 70 80 90 100
DQLVGLSDDL SKLDTSAEAV IRKLVQYFTE VLEEDKSKIA ENLVIGNKDM
110 120 130 140 150
KTYVTKFQWE GAKYPLKQSL KVLSEIIGKQ ISQIDNDLKV KSLTYNNLKN
160 170 180 190 200
ALASMDRKTV GSLLTKDLAD LVKADDFVLN SEYLQTVIVV VPKISVKEWE
210 220 230 240 250
QKYATLSSMV VPGSSKLLTE EGEHALYTVT LFKKVIDEFK NTARENKFIV
260 270 280 290 300
RDFVYDEETL KAGRTERDKL MAEKQRQYAP LIRWLKINFG EIFAAYIHIK
310 320 330 340 350
ALRVFVESVL RYGLPVNFQA AVIEPAKGQQ KKLRQELHKL YIHLDGSAAG
360 370 380
PIDTLEDSPA LMSLGVNEYY PYVFFKLNID FLNK
Length:384
Mass (Da):43,459
Last modified:November 1, 1999 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iFFAC0A9076BEBD42
GO
Isoform b (identifier: Q9XXU9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     98-133: KDMKTYVTKFQWEGAKYPLKQSLKVLSEIIGKQISQ → RHEDVRDEIPMGRCQISTETIVESAQRDYWQTNQPD
     134-384: Missing.

Show »
Length:133
Mass (Da):14,851
Checksum:i0FB2306EB9FBF6F8
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_02313698 – 133KDMKT…KQISQ → RHEDVRDEIPMGRCQISTET IVESAQRDYWQTNQPD in isoform b. CuratedAdd BLAST36
Alternative sequenceiVSP_023137134 – 384Missing in isoform b. CuratedAdd BLAST251

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB009567 mRNA Translation: BAA75067.1
FO080811 Genomic DNA Translation: CCD66967.1
FO080811 Genomic DNA Translation: CCD66968.1

Protein sequence database of the Protein Information Resource

More...
PIRi
T37271

NCBI Reference Sequences

More...
RefSeqi
NP_001023451.1, NM_001028280.3 [Q9XXU9-1]
NP_001023452.1, NM_001028281.3

Genome annotation databases

Ensembl metazoan genome annotation project

More...
EnsemblMetazoai
Y38F2AL.3a.1; Y38F2AL.3a.1; WBGene00006920 [Q9XXU9-1]
Y38F2AL.3b.1; Y38F2AL.3b.1; WBGene00006920 [Q9XXU9-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
177017

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
cel:CELE_Y38F2AL.3

UCSC genome browser

More...
UCSCi
Y38F2AL.3a, c. elegans [Q9XXU9-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB009567 mRNA Translation: BAA75067.1
FO080811 Genomic DNA Translation: CCD66967.1
FO080811 Genomic DNA Translation: CCD66968.1
PIRiT37271
RefSeqiNP_001023451.1, NM_001028280.3 [Q9XXU9-1]
NP_001023452.1, NM_001028281.3

3D structure databases

SMRiQ9XXU9
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi42169, 21 interactors
STRINGi6239.Y38F2AL.3a

Protein family/group databases

TCDBi3.A.2.2.7, the h(+)- or na(+)-translocating f-type, v-type and a-type atpase (f-atpase) superfamily

Proteomic databases

EPDiQ9XXU9
PaxDbiQ9XXU9
PeptideAtlasiQ9XXU9
PRIDEiQ9XXU9

Genome annotation databases

EnsemblMetazoaiY38F2AL.3a.1; Y38F2AL.3a.1; WBGene00006920 [Q9XXU9-1]
Y38F2AL.3b.1; Y38F2AL.3b.1; WBGene00006920 [Q9XXU9-2]
GeneIDi177017
KEGGicel:CELE_Y38F2AL.3
UCSCiY38F2AL.3a, c. elegans [Q9XXU9-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
177017
WormBaseiY38F2AL.3a ; CE29997 ; WBGene00006920 ; vha-11
Y38F2AL.3b ; CE38743 ; WBGene00006920 ; vha-11

Phylogenomic databases

eggNOGiKOG2909, Eukaryota
GeneTreeiENSGT00390000004263
HOGENOMiCLU_017554_3_0_1
InParanoidiQ9XXU9
OMAiETHLIVV
OrthoDBi1016088at2759
PhylomeDBiQ9XXU9

Enzyme and pathway databases

ReactomeiR-CEL-1222556, ROS and RNS production in phagocytes
R-CEL-77387, Insulin receptor recycling
R-CEL-917977, Transferrin endocytosis and recycling
R-CEL-9639288, Amino acids regulate mTORC1
R-CEL-983712, Ion channel transport

Miscellaneous databases

Protein Ontology

More...
PROi
PR:Q9XXU9

Gene expression databases

BgeeiWBGene00006920, Expressed in material anatomical entity and 5 other tissues

Family and domain databases

CDDicd14785, V-ATPase_C, 1 hit
InterProiView protein in InterPro
IPR004907, ATPase_V1-cplx_csu
IPR036132, Vac_ATP_synth_c_sf
PANTHERiPTHR10137, PTHR10137, 1 hit
PfamiView protein in Pfam
PF03223, V-ATPase_C, 1 hit
SUPFAMiSSF118203, SSF118203, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiVATC_CAEEL
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9XXU9
Secondary accession number(s): Q869J4, Q9N421
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 24, 2001
Last sequence update: November 1, 1999
Last modified: April 7, 2021
This is version 140 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programCaenorhabditis annotation project

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Caenorhabditis elegans
    Caenorhabditis elegans: entries, gene names and cross-references to WormBase
  2. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again