Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Probable WRKY transcription factor 4

Gene

WRKY4

Organism
Arabidopsis thaliana (Mouse-ear cress)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Transcription factor that binds specifically to the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. Has a positive role in resistance to necrotrophic pathogens (e.g. Botrytis cinerea), but a negative effect on plant resistance to biotrophic pathogens (e.g. Pseudomonas syringae).2 Publications

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Metal bindingi434Zinc2 Publications1
Metal bindingi436Zinc2 Publications1
Metal bindingi439Zinc2 Publications1
Metal bindingi463Zinc; via pros nitrogen2 Publications1
Metal bindingi465Zinc; via tele nitrogen2 Publications1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
DNA bindingi223 – 287WRKY 1PROSITE-ProRule annotationAdd BLAST65
DNA bindingi403 – 468WRKY 2PROSITE-ProRule annotationAdd BLAST66

GO - Molecular functioni

  • DNA binding Source: TAIR
  • DNA-binding transcription factor activity Source: TAIR
  • metal ion binding Source: UniProtKB-KW
  • sequence-specific DNA binding Source: UniProtKB
  • transcription regulatory region DNA binding Source: UniProtKB

GO - Biological processi

Keywordsi

Molecular functionDNA-binding
Biological processPlant defense, Transcription, Transcription regulation
LigandMetal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Probable WRKY transcription factor 4
Alternative name(s):
WRKY DNA-binding protein 4
Gene namesi
Name:WRKY4
Ordered Locus Names:At1g13960
ORF Names:F16A14.18, F7A19.5
OrganismiArabidopsis thaliana (Mouse-ear cress)
Taxonomic identifieri3702 [NCBI]
Taxonomic lineageiEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliophytaeudicotyledonsGunneridaePentapetalaerosidsmalvidsBrassicalesBrassicaceaeCamelineaeArabidopsis
Proteomesi
  • UP000006548 Componenti: Chromosome 1

Organism-specific databases

AraportiAT1G13960
TAIRilocus:2014799 AT1G13960

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cell wall Cytoskeleton Vacuole Chloroplast Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertion Graphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Disruption phenotypei

Increased sensitivity to the necrotrophic fungal pathogen Botrytis cinerea.1 Publication

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001336471 – 514Probable WRKY transcription factor 4Add BLAST514

Proteomic databases

PaxDbiQ9XI90
PRIDEiQ9XI90

PTM databases

iPTMnetiQ9XI90

Expressioni

Tissue specificityi

In young, mature and senescent leaves.1 Publication

Inductioni

By biotic and abiotic stresses such as pathogen infection (e.g. Botrytis cinerea and Pseudomonas syringae), salicylic acid (SA), jasmonic acid (JA), ethylene (ACC), liquid infiltration or spraying, and strongly during leaf senescence.3 Publications

Gene expression databases

ExpressionAtlasiQ9XI90 baseline and differential
GenevisibleiQ9XI90 AT

Interactioni

Protein-protein interaction databases

BioGridi23196, 1 interactor
STRINGi3702.AT1G13960.1

Structurei

Secondary structure

1514
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliQ9XI90
SMRiQ9XI90
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9XI90

Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi73 – 84Poly-AlaAdd BLAST12

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiENOG410IDX2 Eukaryota
ENOG410YBRT LUCA
HOGENOMiHOG000242409
InParanoidiQ9XI90
OrthoDBiEOG09360DTW
PhylomeDBiQ9XI90

Family and domain databases

Gene3Di2.20.25.80, 2 hits
InterProiView protein in InterPro
IPR003657 WRKY_dom
IPR036576 WRKY_dom_sf
PfamiView protein in Pfam
PF03106 WRKY, 2 hits
SMARTiView protein in SMART
SM00774 WRKY, 2 hits
SUPFAMiSSF118290 SSF118290, 2 hits
PROSITEiView protein in PROSITE
PS50811 WRKY, 2 hits

Sequences (2+)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9XI90-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSEKEEAPST SKSTGAPSRP TLSLPPRPFS EMFFNGGVGF SPGPMTLVSN
60 70 80 90 100
MFPDSDEFRS FSQLLAGAMS SPATAAAAAA AATASDYQRL GEGTNSSSGD
110 120 130 140 150
VDPRFKQNRP TGLMISQSQS PSMFTVPPGL SPAMLLDSPS FLGLFSPVQG
160 170 180 190 200
SYGMTHQQAL AQVTAQAVQA NANMQPQTEY PPPSQVQSFS SGQAQIPTSA
210 220 230 240 250
PLPAQRETSD VTIIEHRSQQ PLNVDKPADD GYNWRKYGQK QVKGSEFPRS
260 270 280 290 300
YYKCTNPGCP VKKKVERSLD GQVTEIIYKG QHNHEPPQNT KRGNKDNTAN
310 320 330 340 350
INGSSINNNR GSSELGASQF QTNSSNKTKR EQHEAVSQAT TTEHLSEASD
360 370 380 390 400
GEEVGNGETD VREKDENEPD PKRRSTEVRI SEPAPAASHR TVTEPRIIVQ
410 420 430 440 450
TTSEVDLLDD GYRWRKYGQK VVKGNPYPRS YYKCTTPGCG VRKHVERAAT
460 470 480 490 500
DPKAVVTTYE GKHNHDLPAA KSSSHAAAAA QLRPDNRPGG LANLNQQQQQ
510
QPVARLRLKE EQTT
Length:514
Mass (Da):55,816
Last modified:May 15, 2002 - v2
Checksum:i01010F8745C420C5
GO
Isoform 2 (identifier: Q9XI90-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     112-147: GLMISQSQSPSMFTVPPGLSPAMLLDSPSFLGLFSP → AVLDLICNI

Show »
Length:487
Mass (Da):53,050
Checksum:iB046542E120086C7
GO

Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A2H1ZEB2A0A2H1ZEB2_ARATH
WRKY DNA-binding protein 4
WRKY4 WRKY DNA-binding protein 4, At1g13960, F16A14.18
361Annotation score:

Sequence cautioni

The sequence AAD39282 differs from that shown. Reason: Erroneous gene model prediction.Curated
The sequence AAF79402 differs from that shown. Reason: Erroneous gene model prediction.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_008969112 – 147GLMIS…GLFSP → AVLDLICNI in isoform 2. 1 PublicationAdd BLAST36

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF224703 mRNA Translation: AAK28313.1
AF425835 mRNA Translation: AAL13048.1
AC007576 Genomic DNA Translation: AAD39282.1 Sequence problems.
AC068197 Genomic DNA Translation: AAF79402.1 Sequence problems.
CP002684 Genomic DNA Translation: AEE29089.1
AY045676 mRNA Translation: AAK74034.1
BT002629 mRNA Translation: AAO11545.1
PIRiG86272
RefSeqiNP_172849.1, NM_101262.3 [Q9XI90-1]
UniGeneiAt.20024

Genome annotation databases

EnsemblPlantsiAT1G13960.1; AT1G13960.1; AT1G13960 [Q9XI90-1]
GeneIDi837956
GrameneiAT1G13960.1; AT1G13960.1; AT1G13960 [Q9XI90-1]
KEGGiath:AT1G13960

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF224703 mRNA Translation: AAK28313.1
AF425835 mRNA Translation: AAL13048.1
AC007576 Genomic DNA Translation: AAD39282.1 Sequence problems.
AC068197 Genomic DNA Translation: AAF79402.1 Sequence problems.
CP002684 Genomic DNA Translation: AEE29089.1
AY045676 mRNA Translation: AAK74034.1
BT002629 mRNA Translation: AAO11545.1
PIRiG86272
RefSeqiNP_172849.1, NM_101262.3 [Q9XI90-1]
UniGeneiAt.20024

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1WJ2NMR-A399-469[»]
2LEXNMR-A399-469[»]
ProteinModelPortaliQ9XI90
SMRiQ9XI90
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi23196, 1 interactor
STRINGi3702.AT1G13960.1

PTM databases

iPTMnetiQ9XI90

Proteomic databases

PaxDbiQ9XI90
PRIDEiQ9XI90

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsemblPlantsiAT1G13960.1; AT1G13960.1; AT1G13960 [Q9XI90-1]
GeneIDi837956
GrameneiAT1G13960.1; AT1G13960.1; AT1G13960 [Q9XI90-1]
KEGGiath:AT1G13960

Organism-specific databases

AraportiAT1G13960
TAIRilocus:2014799 AT1G13960

Phylogenomic databases

eggNOGiENOG410IDX2 Eukaryota
ENOG410YBRT LUCA
HOGENOMiHOG000242409
InParanoidiQ9XI90
OrthoDBiEOG09360DTW
PhylomeDBiQ9XI90

Miscellaneous databases

EvolutionaryTraceiQ9XI90
PROiPR:Q9XI90

Gene expression databases

ExpressionAtlasiQ9XI90 baseline and differential
GenevisibleiQ9XI90 AT

Family and domain databases

Gene3Di2.20.25.80, 2 hits
InterProiView protein in InterPro
IPR003657 WRKY_dom
IPR036576 WRKY_dom_sf
PfamiView protein in Pfam
PF03106 WRKY, 2 hits
SMARTiView protein in SMART
SM00774 WRKY, 2 hits
SUPFAMiSSF118290 SSF118290, 2 hits
PROSITEiView protein in PROSITE
PS50811 WRKY, 2 hits
ProtoNetiSearch...

Entry informationi

Entry nameiWRKY4_ARATH
AccessioniPrimary (citable) accession number: Q9XI90
Secondary accession number(s): Q93WN8, Q9LMG1
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 15, 2002
Last sequence update: May 15, 2002
Last modified: November 7, 2018
This is version 130 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programPlant Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Arabidopsis thaliana
    Arabidopsis thaliana: entries and gene names
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again