Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

RNA-binding protein with multiple splicing

Gene

Rbpms

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Acts as a coactivator of transcriptional activity. Required to increase TGFB1/Smad-mediated transactivation. Acts through SMAD2, SMAD3 and SMAD4 to increase transcriptional activity. Increases phosphorylation of SMAD2 and SMAD3 on their C-terminal SSXS motif, possibly through recruitment of TGFBR1. Promotes the nuclear accumulation of SMAD2, SMAD3 and SMAD4 proteins. Binds to poly(A) RNA.By similarity

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionActivator, RNA-binding
Biological processTranscription, Transcription regulation

Names & Taxonomyi

Protein namesi
Recommended name:
RNA-binding protein with multiple splicing
Short name:
RBP-MS
Alternative name(s):
Heart and RRM expressed sequence
Short name:
Hermes
Gene namesi
Name:Rbpms
Synonyms:Hermes
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 8

Organism-specific databases

MGIiMGI:1334446 Rbpms

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000817941 – 197RNA-binding protein with multiple splicingAdd BLAST197

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei1N-acetylmethionineBy similarity1
Modified residuei12PhosphothreonineCombined sources1
Modified residuei113PhosphothreonineBy similarity1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

PaxDbiQ9WVB0
PRIDEiQ9WVB0

PTM databases

iPTMnetiQ9WVB0
PhosphoSitePlusiQ9WVB0

Expressioni

Tissue specificityi

mRNA expressed in developing heart, with significantly higher expression in the atria relative to the ventricles.1 Publication

Developmental stagei

mRNA already detected at E9.5.1 Publication

Gene expression databases

BgeeiENSMUSG00000031586 Expressed in 260 organ(s), highest expression level in aorta
CleanExiMM_RBPMS
ExpressionAtlasiQ9WVB0 baseline and differential
GenevisibleiQ9WVB0 MM

Interactioni

Subunit structurei

Homodimer; each protein chain binds one RNA molecule via the external surface of the homodimer. Interacts with SMAD2, SMAD3 and SMAD4; the interactions are direct.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sitei27Interaction with RNABy similarity1
Sitei61Interaction with RNABy similarity1

GO - Molecular functioni

Protein-protein interaction databases

BioGridi202831, 3 interactors
IntActiQ9WVB0, 1 interactor
MINTiQ9WVB0
STRINGi10090.ENSMUSP00000033995

Structurei

3D structure databases

ProteinModelPortaliQ9WVB0
SMRiQ9WVB0
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini24 – 101RRMPROSITE-ProRule annotationAdd BLAST78

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni98 – 105Interaction with RNABy similarity8

Domaini

The RRM domain is necessary for interaction with SMAD4. Both the RRM domain and the C-terminus are required for TGFB1/Smad-mediated transactivation activity (By similarity).By similarity

Phylogenomic databases

eggNOGiKOG1457 Eukaryota
ENOG410XSBT LUCA
GeneTreeiENSGT00500000044861
HOGENOMiHOG000017369
HOVERGENiHBG069897
InParanoidiQ9WVB0
OMAiFITREPY
OrthoDBiEOG091G0K3T
TreeFamiTF351070

Family and domain databases

Gene3Di3.30.70.330, 1 hit
InterProiView protein in InterPro
IPR012677 Nucleotide-bd_a/b_plait_sf
IPR035979 RBD_domain_sf
IPR000504 RRM_dom
PfamiView protein in Pfam
PF00076 RRM_1, 1 hit
SMARTiView protein in SMART
SM00360 RRM, 1 hit
SUPFAMiSSF54928 SSF54928, 1 hit
PROSITEiView protein in PROSITE
PS50102 RRM, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9WVB0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MNGGGKAEKE NTPSEANLQE EEVRTLFVSG LPLDIKPREL YLLFRPFKGY
60 70 80 90 100
EGSLIKLTSK QPVGFVSFDS RSEAEAAKNA LNGIRFDPEI PQTLRLEFAK
110 120 130 140 150
ANTKMAKNKL VGTPNPSTPL PNTVPQFIAR EPYELTVPAL YPSSPEVWAP
160 170 180 190
YPLYPAELAP ALPPPAAFTY PASLHAQMRW IPPSEATSQG WKSRQFC
Length:197
Mass (Da):21,816
Last modified:March 6, 2013 - v2
Checksum:i03457D84F803CC78
GO
Isoform 2 (identifier: Q9WVB0-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     178-197: MRWIPPSEATSQGWKSRQFC → CFSPEAKPNTPVFCPLLQQIRFVSGNVFVTYQPTADQQRELPC

Show »
Length:220
Mass (Da):24,291
Checksum:iF507707B142231BD
GO

Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
T1ECW4T1ECW4_MOUSE
RNA-binding protein with multiple-s...
Rbpms
191Annotation score:
S4R1Y2S4R1Y2_MOUSE
RNA-binding protein with multiple-s...
Rbpms
159Annotation score:
S4R1A1S4R1A1_MOUSE
RNA-binding protein with multiple-s...
Rbpms
93Annotation score:
S4R2P3S4R2P3_MOUSE
RNA-binding protein with multiple-s...
Rbpms
64Annotation score:
S4R280S4R280_MOUSE
RNA-binding protein with multiple-s...
Rbpms
70Annotation score:
S4R1T1S4R1T1_MOUSE
RNA-binding protein with multiple-s...
Rbpms
58Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti96L → I in AAD39515 (PubMed:10096065).Curated1
Sequence conflicti126 – 128QFI → HSV in AAD39515 (PubMed:10096065).Curated3

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_045747178 – 197MRWIP…SRQFC → CFSPEAKPNTPVFCPLLQQI RFVSGNVFVTYQPTADQQRE LPC in isoform 2. 1 PublicationAdd BLAST20

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF148511 mRNA Translation: AAD39515.1
AK012265 mRNA Translation: BAB28128.1
AK012586 mRNA Translation: BAB28336.1
AK041118 mRNA Translation: BAC30827.1
AC123616 Genomic DNA No translation available.
AC127551 Genomic DNA No translation available.
AC162523 Genomic DNA No translation available.
BC030397 mRNA Translation: AAH30397.1
CCDSiCCDS40317.1 [Q9WVB0-1]
CCDS40318.1 [Q9WVB0-2]
RefSeqiNP_001036139.1, NM_001042674.2 [Q9WVB0-1]
NP_001036140.1, NM_001042675.2 [Q9WVB0-2]
NP_062707.1, NM_019733.3 [Q9WVB0-1]
UniGeneiMm.323997

Genome annotation databases

EnsembliENSMUST00000033995; ENSMUSP00000033995; ENSMUSG00000031586 [Q9WVB0-2]
ENSMUST00000053251; ENSMUSP00000055813; ENSMUSG00000031586 [Q9WVB0-1]
ENSMUST00000182987; ENSMUSP00000138483; ENSMUSG00000031586 [Q9WVB0-1]
ENSMUST00000191473; ENSMUSP00000140387; ENSMUSG00000031586 [Q9WVB0-1]
GeneIDi19663
KEGGimmu:19663
UCSCiuc009lkk.2 mouse [Q9WVB0-1]
uc009lkn.3 mouse [Q9WVB0-2]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF148511 mRNA Translation: AAD39515.1
AK012265 mRNA Translation: BAB28128.1
AK012586 mRNA Translation: BAB28336.1
AK041118 mRNA Translation: BAC30827.1
AC123616 Genomic DNA No translation available.
AC127551 Genomic DNA No translation available.
AC162523 Genomic DNA No translation available.
BC030397 mRNA Translation: AAH30397.1
CCDSiCCDS40317.1 [Q9WVB0-1]
CCDS40318.1 [Q9WVB0-2]
RefSeqiNP_001036139.1, NM_001042674.2 [Q9WVB0-1]
NP_001036140.1, NM_001042675.2 [Q9WVB0-2]
NP_062707.1, NM_019733.3 [Q9WVB0-1]
UniGeneiMm.323997

3D structure databases

ProteinModelPortaliQ9WVB0
SMRiQ9WVB0
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi202831, 3 interactors
IntActiQ9WVB0, 1 interactor
MINTiQ9WVB0
STRINGi10090.ENSMUSP00000033995

PTM databases

iPTMnetiQ9WVB0
PhosphoSitePlusiQ9WVB0

Proteomic databases

PaxDbiQ9WVB0
PRIDEiQ9WVB0

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000033995; ENSMUSP00000033995; ENSMUSG00000031586 [Q9WVB0-2]
ENSMUST00000053251; ENSMUSP00000055813; ENSMUSG00000031586 [Q9WVB0-1]
ENSMUST00000182987; ENSMUSP00000138483; ENSMUSG00000031586 [Q9WVB0-1]
ENSMUST00000191473; ENSMUSP00000140387; ENSMUSG00000031586 [Q9WVB0-1]
GeneIDi19663
KEGGimmu:19663
UCSCiuc009lkk.2 mouse [Q9WVB0-1]
uc009lkn.3 mouse [Q9WVB0-2]

Organism-specific databases

CTDi11030
MGIiMGI:1334446 Rbpms

Phylogenomic databases

eggNOGiKOG1457 Eukaryota
ENOG410XSBT LUCA
GeneTreeiENSGT00500000044861
HOGENOMiHOG000017369
HOVERGENiHBG069897
InParanoidiQ9WVB0
OMAiFITREPY
OrthoDBiEOG091G0K3T
TreeFamiTF351070

Miscellaneous databases

ChiTaRSiRbpms mouse
PROiPR:Q9WVB0
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000031586 Expressed in 260 organ(s), highest expression level in aorta
CleanExiMM_RBPMS
ExpressionAtlasiQ9WVB0 baseline and differential
GenevisibleiQ9WVB0 MM

Family and domain databases

Gene3Di3.30.70.330, 1 hit
InterProiView protein in InterPro
IPR012677 Nucleotide-bd_a/b_plait_sf
IPR035979 RBD_domain_sf
IPR000504 RRM_dom
PfamiView protein in Pfam
PF00076 RRM_1, 1 hit
SMARTiView protein in SMART
SM00360 RRM, 1 hit
SUPFAMiSSF54928 SSF54928, 1 hit
PROSITEiView protein in PROSITE
PS50102 RRM, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiRBPMS_MOUSE
AccessioniPrimary (citable) accession number: Q9WVB0
Secondary accession number(s): Q78HG1, Q9CPU5
Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 21, 2001
Last sequence update: March 6, 2013
Last modified: November 7, 2018
This is version 126 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again