Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Band 4.1-like protein 3

Gene

Epb41l3

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Tumor suppressor that inhibits cell proliferation and promotes apoptosis. Modulates the activity of protein arginine N-methyltransferases, including PRMT3 and PRMT5 (By similarity).By similarity

Miscellaneous

The complete SAB domain is present only in the heart-specific isoforms (isoform 2 and isoform 5).

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • actin binding Source: UniProtKB-KW
  • structural constituent of cytoskeleton Source: BHF-UCL

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActin-binding
Biological processApoptosis

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-6794361 Neurexins and neuroligins

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Band 4.1-like protein 3
Alternative name(s):
4.1B
Differentially expressed in adenocarcinoma of the lung protein 1
Short name:
DAL-1
Short name:
DAL1P
Short name:
mDAL-1
Cleaved into the following chain:
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Epb41l3
Synonyms:Dal1, Epb4.1l3, Kiaa0987
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 17

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:103008 Epb41l3

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell junction, Cell membrane, Cytoplasm, Cytoskeleton, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Keywords - Diseasei

Tumor suppressor

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00004231951 – 929Band 4.1-like protein 3Add BLAST929
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemoved; alternateBy similarity
ChainiPRO_00002194002 – 929Band 4.1-like protein 3, N-terminally processedAdd BLAST928

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei1N-acetylmethionineBy similarity1
Modified residuei2N-acetylthreonine; in Band 4.1-like protein 3, N-terminally processedBy similarity1
Modified residuei96PhosphoserineCombined sources1
Modified residuei428PhosphoserineBy similarity1
Modified residuei451PhosphoserineCombined sources1
Modified residuei486PhosphoserineCombined sources1
Modified residuei495PhosphothreonineCombined sources1
Modified residuei518PhosphothreonineCombined sources1
Modified residuei543PhosphoserineCombined sources1
Modified residuei545PhosphothreonineCombined sources1
Modified residuei547PhosphoserineCombined sources1
Modified residuei725PhosphothreonineCombined sources1
Modified residuei802PhosphoserineCombined sources1
Modified residuei804PhosphoserineCombined sources1
Modified residuei923PhosphothreonineCombined sources1
Isoform 7 (identifier: Q9WV92-7)
Modified residuei451PhosphoserineCombined sources1
Modified residuei525PhosphoserineCombined sources1
Isoform 8 (identifier: Q9WV92-8)
Modified residuei451PhosphoserineCombined sources1
Isoform 3 (identifier: Q9WV92-3)
Modified residuei543PhosphoserineCombined sources1
Isoform 6 (identifier: Q9WV92-6)
Modified residuei543PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9WV92

PeptideAtlas

More...
PeptideAtlasi
Q9WV92

PRoteomics IDEntifications database

More...
PRIDEi
Q9WV92

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9WV92

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9WV92

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q9WV92

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Detected in brain (at protein level). Highest expression in brain, lower in testis, adrenal gland, heart and kidney. Also present in muscle and epithelial cells. Isoform 1 is expressed in brain, isoform 2 is expressed in heart and isoform 3 is mostly expressed in kidney but also in heart and brain. Isoform 6 seems to be most abundant in kidney while isoform 4 and isoform 5 are predominantly expressed in heart and brain.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000024044 Expressed in 265 organ(s), highest expression level in dorsal root ganglion

CleanEx database of gene expression profiles

More...
CleanExi
MM_EPB4.1L3

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9WV92 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9WV92 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts (via FERM domain) with CADM1. Interacts with PRMT3, PRMT5 and PRMT6 (By similarity). Isoform 2 (heart-specific) has the complete spectrin--actin-binding (SAB) domain and fully interacts with spectrin and actin.By similarity1 Publication

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
199461, 12 interactors

Protein interaction database and analysis system

More...
IntActi
Q9WV92, 16 interactors

Molecular INTeraction database

More...
MINTi
Q9WV92

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000079098

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q9WV92

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9WV92

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini118 – 399FERMPROSITE-ProRule annotationAdd BLAST282

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni402 – 528HydrophilicAdd BLAST127
Regioni559 – 602Spectrin--actin-bindingAdd BLAST44
Regioni777 – 929C-terminal (CTD)Add BLAST153

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3527 Eukaryota
ENOG410Y7NQ LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000157047

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000228840

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG007777

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9WV92

KEGG Orthology (KO)

More...
KOi
K06107

Database of Orthologous Groups

More...
OrthoDBi
EOG091G00IL

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9WV92

TreeFam database of animal gene trees

More...
TreeFami
TF351626

Family and domain databases

Conserved Domains Database

More...
CDDi
cd14473 FERM_B-lobe, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.20.80.10, 1 hit
2.30.29.30, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR030691 Band4.1-L3
IPR008379 Band_4.1_C
IPR019749 Band_41_domain
IPR000798 Ez/rad/moesin-like
IPR014847 FERM-adjacent
IPR014352 FERM/acyl-CoA-bd_prot_sf
IPR035963 FERM_2
IPR019748 FERM_central
IPR019747 FERM_CS
IPR000299 FERM_domain
IPR018979 FERM_N
IPR018980 FERM_PH-like_C
IPR011993 PH-like_dom_sf
IPR007477 SAB_dom
IPR029071 Ubiquitin-like_domsf

The PANTHER Classification System

More...
PANTHERi
PTHR23280:SF20 PTHR23280:SF20, 2 hits

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF05902 4_1_CTD, 1 hit
PF08736 FA, 1 hit
PF09380 FERM_C, 1 hit
PF00373 FERM_M, 1 hit
PF09379 FERM_N, 1 hit
PF04382 SAB, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00935 BAND41
PR00661 ERMFAMILY

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00295 B41, 1 hit
SM01195 FA, 1 hit
SM01196 FERM_C, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF47031 SSF47031, 1 hit
SSF54236 SSF54236, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00660 FERM_1, 1 hit
PS00661 FERM_2, 1 hit
PS50057 FERM_3, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (8+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 8 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Note: Experimental confirmation may be lacking for some isoforms.

This entry has 8 described isoforms and 8 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9WV92-1) [UniParc]FASTAAdd to basket
Also known as: 4.1B-brain

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MTTESGSDSE SKPDQEAEPQ EAAGPQGQAG AQPGPEPAGG NGSLNGEKQQ
60 70 80 90 100
PALEQFPEAA AHSTPVKREI GDKDRDFAAA AAKQLEYQQF EDDKLSQRSS
110 120 130 140 150
SSKLSRSPLK IVKRPKSMQC KVTLLDGSEY GCDVDKRSRG QVLFDKVCEH
160 170 180 190 200
LNLLEKDYFG LTYRDAENQK NWLDPAKEIK KQIRSGAWHF SFNVKFYPPD
210 220 230 240 250
PAQLSEDITR YYLCLQLRDD IVSGRLPCSF VTLALLGSYT VQSELGDYDP
260 270 280 290 300
DECGNDYISE FRFAPNHTKE LEDKVIELHK SHRGMTPAEA EMHFLENAKK
310 320 330 340 350
LSMYGVDLHH AKDSEGVEIM LGVCASGLLI YRDRLRINRF AWPKVLKISY
360 370 380 390 400
KRNNFYIKIR PGEFEQFEST IGFKLPNHRA AKRLWKVCVE HHTFFRLLLP
410 420 430 440 450
EAPPKKFLTL GSKFRYSGRT QAQTRRASAL IDRPAPYFER SSSKRYTMSR
460 470 480 490 500
SLDGASVSEN HEIYMKDSVS AAEVGTGQYA TTKGISQTNL ITTVTPEKKA
510 520 530 540 550
EEERVEEEDR RKKAEEATPV TALRHEGKTD SERTDTAADG ETSATESDQE
560 570 580 590 600
EDAEIKAQDL DKTQDELMKH QTNISELKRT FLETSTETAL TNEWEKRLST
610 620 630 640 650
SPVRLAARQE DAPMIEPLVP EETKQSSGEK LMDGSEILSL LESARKPTEF
660 670 680 690 700
IGGVSSTTQS WVQKLETKTE PVEAEVESTP HPQPLSTEKV LQETILVEER
710 720 730 740 750
HVMSVHASGD ASHTARDEVD AAESTPTDRR HTGKGKEGSS VTEAAKEQRG
760 770 780 790 800
EEVDQSAPEQ EQPATVSHEE EQASTIRTSE GLEQKSHFES STVRVESTSV
810 820 830 840 850
GSISPGGAKL EISTKEVPVV HTETKTITYE SSQVDPGADL EPGVLMSAQT
860 870 880 890 900
ITSETTSTTT TTHITKTVKG GISETRIEKR IVITGDADID HDQALAQAIK
910 920
EAKEQHPDMS VTKVVVHKET EITPEDGED
Length:929
Mass (Da):103,338
Last modified:November 1, 1999 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iF4975FF405DA44AE
GO
Isoform 2 (identifier: Q9WV92-2) [UniParc]FASTAAdd to basket
Also known as: 4.1B-heart

The sequence of this isoform differs from the canonical sequence as follows:
     547-558: Missing.
     559-559: D → NSLIKRIKGENVYVKHSNLMLED

Show »
Length:939
Mass (Da):104,561
Checksum:i389443CDEF2CC2A5
GO
Isoform 3 (identifier: Q9WV92-3) [UniParc]FASTAAdd to basket
Also known as: 4.1B-kidney

The sequence of this isoform differs from the canonical sequence as follows:
     547-558: Missing.

Show »
Length:917
Mass (Da):101,993
Checksum:iD0EF7EA95EDA3C24
GO
Isoform 4 (identifier: Q9WV92-4) [UniParc]FASTAAdd to basket
Also known as: 4.1b-brain

The sequence of this isoform differs from the canonical sequence as follows:
     894-929: ALAQAIKEAKEQHPDMSVTKVVVHKETEITPEDGED → E

Show »
Length:894
Mass (Da):99,510
Checksum:i2E5E5915A9568B81
GO
Isoform 5 (identifier: Q9WV92-5) [UniParc]FASTAAdd to basket
Also known as: 4.1B-heart

The sequence of this isoform differs from the canonical sequence as follows:
     547-558: Missing.
     559-559: D → NSLIKRIKGENVYVKHSNLMLED
     894-929: ALAQAIKEAKEQHPDMSVTKVVVHKETEITPEDGED → E

Show »
Length:904
Mass (Da):100,734
Checksum:i12419E015BB8DD08
GO
Isoform 6 (identifier: Q9WV92-6) [UniParc]FASTAAdd to basket
Also known as: 4.1B-kidney

The sequence of this isoform differs from the canonical sequence as follows:
     547-558: Missing.
     894-929: ALAQAIKEAKEQHPDMSVTKVVVHKETEITPEDGED → E

Show »
Length:882
Mass (Da):98,166
Checksum:i94CC9620418FDF2C
GO
Isoform 7 (identifier: Q9WV92-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     455-472: Missing.
     547-558: Missing.
     623-663: Missing.
     894-929: ALAQAIKEAKEQHPDMSVTKVVVHKETEITPEDGED → E

Note: Inferred from the cDNA sequence of Ref. 2.Combined sources
Show »
Length:823
Mass (Da):91,850
Checksum:i2F78D9ADA3DC0674
GO
Isoform 8 (identifier: Q9WV92-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     455-472: Missing.
     528-528: K → KSPPGHGAAD...NDPSDSSEEE
     894-929: ALAQAIKEAKEQHPDMSVTKVVVHKETEITPEDGED → E

Show »
Length:1,052
Mass (Da):116,785
Checksum:i3D9A917D79B9E7F5
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 8 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A7YY80A7YY80_MOUSE
130kDa Protein 4.1B MEF cell isofor...
Epb41l3 Epb4.1l3
876Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A286YDY4A0A286YDY4_MOUSE
Band 4.1-like protein 3
Epb41l3
852Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A286YD84A0A286YD84_MOUSE
Band 4.1-like protein 3
Epb41l3
605Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A286YCY1A0A286YCY1_MOUSE
Band 4.1-like protein 3
Epb41l3
262Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A286YCT6A0A286YCT6_MOUSE
Band 4.1-like protein 3
Epb41l3
223Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A286YCY8A0A286YCY8_MOUSE
Band 4.1-like protein 3
Epb41l3
287Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A286YDD0A0A286YDD0_MOUSE
Band 4.1-like protein 3
Epb41l3
53Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A286YD94A0A286YD94_MOUSE
Band 4.1-like protein 3
Epb41l3
29Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAD51365 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti6 – 10GSDSE → RIRLR in AAD51365 (Ref. 2) Curated5
Sequence conflicti28Q → R in AAD51365 (Ref. 2) Curated1
Sequence conflicti288A → V in AAD51365 (Ref. 2) Curated1
Sequence conflicti306V → G in AAD51365 (Ref. 2) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_000487455 – 472Missing in isoform 7 and isoform 8. 2 PublicationsAdd BLAST18
Alternative sequenceiVSP_023063528K → KSPPGHGAADSCPPSPPSAH PDPPPPTELRRRCKEKERAE PSSLESEAQGKAYLGDQDVA FSYRQPAGKGTTLFSFSLQL PESFPSLLDEDGYLSFPNLS ETNLLPQSWQHFLPIRSPSL LPCFLFIFFFLLSASFSVPY ALTLSFPLALCLCYLEPKAA SLSASLDNDPSDSSEEE in isoform 8. 1 Publication1
Alternative sequenceiVSP_000490547 – 558Missing in isoform 2, isoform 3, isoform 5, isoform 6 and isoform 7. 2 PublicationsAdd BLAST12
Alternative sequenceiVSP_000489559D → NSLIKRIKGENVYVKHSNLM LED in isoform 2 and isoform 5. 1 Publication1
Alternative sequenceiVSP_000488623 – 663Missing in isoform 7. 1 PublicationAdd BLAST41
Alternative sequenceiVSP_000491894 – 929ALAQA…EDGED → E in isoform 4, isoform 5, isoform 6, isoform 7 and isoform 8. 3 PublicationsAdd BLAST36

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF152247 mRNA Translation: AAD38048.1
AF177146 mRNA Translation: AAD51365.1 Different initiation.
AK173080 mRNA Translation: BAD32358.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS28952.1 [Q9WV92-1]

NCBI Reference Sequences

More...
RefSeqi
NP_038841.1, NM_013813.1 [Q9WV92-1]
XP_011244586.1, XM_011246284.1 [Q9WV92-8]
XP_011244591.1, XM_011246289.1 [Q9WV92-7]
XP_017172724.1, XM_017317235.1 [Q9WV92-4]
XP_017172725.1, XM_017317236.1

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Mm.131135

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000080208; ENSMUSP00000079098; ENSMUSG00000024044 [Q9WV92-1]
ENSMUST00000112680; ENSMUSP00000108300; ENSMUSG00000024044 [Q9WV92-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
13823

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:13823

UCSC genome browser

More...
UCSCi
uc008dkp.1 mouse [Q9WV92-1]
uc008dkq.1 mouse [Q9WV92-7]
uc008dkr.1 mouse [Q9WV92-8]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF152247 mRNA Translation: AAD38048.1
AF177146 mRNA Translation: AAD51365.1 Different initiation.
AK173080 mRNA Translation: BAD32358.1
CCDSiCCDS28952.1 [Q9WV92-1]
RefSeqiNP_038841.1, NM_013813.1 [Q9WV92-1]
XP_011244586.1, XM_011246284.1 [Q9WV92-8]
XP_011244591.1, XM_011246289.1 [Q9WV92-7]
XP_017172724.1, XM_017317235.1 [Q9WV92-4]
XP_017172725.1, XM_017317236.1
UniGeneiMm.131135

3D structure databases

ProteinModelPortaliQ9WV92
SMRiQ9WV92
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi199461, 12 interactors
IntActiQ9WV92, 16 interactors
MINTiQ9WV92
STRINGi10090.ENSMUSP00000079098

PTM databases

iPTMnetiQ9WV92
PhosphoSitePlusiQ9WV92
SwissPalmiQ9WV92

Proteomic databases

PaxDbiQ9WV92
PeptideAtlasiQ9WV92
PRIDEiQ9WV92

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
13823
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000080208; ENSMUSP00000079098; ENSMUSG00000024044 [Q9WV92-1]
ENSMUST00000112680; ENSMUSP00000108300; ENSMUSG00000024044 [Q9WV92-2]
GeneIDi13823
KEGGimmu:13823
UCSCiuc008dkp.1 mouse [Q9WV92-1]
uc008dkq.1 mouse [Q9WV92-7]
uc008dkr.1 mouse [Q9WV92-8]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
23136
MGIiMGI:103008 Epb41l3

Rodent Unidentified Gene-Encoded large proteins database

More...
Rougei
Search...

Phylogenomic databases

eggNOGiKOG3527 Eukaryota
ENOG410Y7NQ LUCA
GeneTreeiENSGT00940000157047
HOGENOMiHOG000228840
HOVERGENiHBG007777
InParanoidiQ9WV92
KOiK06107
OrthoDBiEOG091G00IL
PhylomeDBiQ9WV92
TreeFamiTF351626

Enzyme and pathway databases

ReactomeiR-MMU-6794361 Neurexins and neuroligins

Miscellaneous databases

Protein Ontology

More...
PROi
PR:Q9WV92

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000024044 Expressed in 265 organ(s), highest expression level in dorsal root ganglion
CleanExiMM_EPB4.1L3
ExpressionAtlasiQ9WV92 baseline and differential
GenevisibleiQ9WV92 MM

Family and domain databases

CDDicd14473 FERM_B-lobe, 1 hit
Gene3Di1.20.80.10, 1 hit
2.30.29.30, 1 hit
InterProiView protein in InterPro
IPR030691 Band4.1-L3
IPR008379 Band_4.1_C
IPR019749 Band_41_domain
IPR000798 Ez/rad/moesin-like
IPR014847 FERM-adjacent
IPR014352 FERM/acyl-CoA-bd_prot_sf
IPR035963 FERM_2
IPR019748 FERM_central
IPR019747 FERM_CS
IPR000299 FERM_domain
IPR018979 FERM_N
IPR018980 FERM_PH-like_C
IPR011993 PH-like_dom_sf
IPR007477 SAB_dom
IPR029071 Ubiquitin-like_domsf
PANTHERiPTHR23280:SF20 PTHR23280:SF20, 2 hits
PfamiView protein in Pfam
PF05902 4_1_CTD, 1 hit
PF08736 FA, 1 hit
PF09380 FERM_C, 1 hit
PF00373 FERM_M, 1 hit
PF09379 FERM_N, 1 hit
PF04382 SAB, 1 hit
PRINTSiPR00935 BAND41
PR00661 ERMFAMILY
SMARTiView protein in SMART
SM00295 B41, 1 hit
SM01195 FA, 1 hit
SM01196 FERM_C, 1 hit
SUPFAMiSSF47031 SSF47031, 1 hit
SSF54236 SSF54236, 1 hit
PROSITEiView protein in PROSITE
PS00660 FERM_1, 1 hit
PS00661 FERM_2, 1 hit
PS50057 FERM_3, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiE41L3_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9WV92
Secondary accession number(s): Q69ZT8, Q9R102
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 23, 2002
Last sequence update: November 1, 1999
Last modified: December 5, 2018
This is version 163 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again