Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Kinesin-like protein KIF2A

Gene

Kif2a

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Plus end-directed microtubule-dependent motor required for normal brain development. May regulate microtubule dynamics during axonal growth. Required for normal progression through mitosis. Required for normal congress of chromosomes at the metaphase plate. Required for normal spindle dynamics during mitosis. Promotes spindle turnover. Implicated in formation of bipolar mitotic spindles. Has microtubule depolymerization activity (By similarity).By similarity

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi312 – 319ATPPROSITE-ProRule annotation8

GO - Molecular functioni

  • ATPase activity Source: GO_Central
  • ATP binding Source: UniProtKB-KW
  • microtubule binding Source: InterPro
  • microtubule motor activity Source: GO_Central
  • protein kinase binding Source: ARUK-UCL

GO - Biological processi

Keywordsi

Molecular functionDevelopmental protein, Motor protein
Biological processCell cycle, Cell division, Differentiation, Mitosis, Neurogenesis
LigandATP-binding, Nucleotide-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Kinesin-like protein KIF2A
Alternative name(s):
Kinesin-2
Gene namesi
Name:Kif2aBy similarity
Synonyms:Kif2Imported
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeRattus
Proteomesi
  • UP000002494 Componenti: Unplaced

Organism-specific databases

RGDi70974 Kif2a

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Microtubule

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003062731 – 705Kinesin-like protein KIF2AAdd BLAST705

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei75PhosphoserineCombined sources1
Modified residuei96PhosphothreonineBy similarity1
Modified residuei99PhosphoserineBy similarity1
Modified residuei101N6-acetyllysineBy similarity1
Modified residuei134PhosphoserineBy similarity1
Modified residuei139PhosphoserineBy similarity1
Isoform 21 Publication (identifier: Q9WV63-2)
Modified residuei572PhosphoserineCombined sourcesCurated1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

PRIDEiQ9WV63

PTM databases

iPTMnetiQ9WV63
PhosphoSitePlusiQ9WV63

Interactioni

Subunit structurei

Interacts with AURKA, PSRC1 and PLK1.By similarity

GO - Molecular functioni

Protein-protein interaction databases

IntActiQ9WV63, 1 interactor

Structurei

3D structure databases

ProteinModelPortaliQ9WV63
SMRiQ9WV63
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini222 – 552Kinesin motorPROSITE-ProRule annotationAdd BLAST331

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili153 – 186Sequence analysisAdd BLAST34
Coiled coili659 – 698Sequence analysisAdd BLAST40

Sequence similaritiesi

Belongs to the TRAFAC class myosin-kinesin ATPase superfamily. Kinesin family. MCAK/KIF2 subfamily.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil

Phylogenomic databases

HOGENOMiHOG000231329
HOVERGENiHBG003875
InParanoidiQ9WV63
PhylomeDBiQ9WV63

Family and domain databases

Gene3Di3.40.850.10, 1 hit
InterProiView protein in InterPro
IPR027640 Kinesin-like_fam
IPR019821 Kinesin_motor_CS
IPR001752 Kinesin_motor_dom
IPR036961 Kinesin_motor_dom_sf
IPR027417 P-loop_NTPase
PANTHERiPTHR24115 PTHR24115, 1 hit
PfamiView protein in Pfam
PF00225 Kinesin, 1 hit
PRINTSiPR00380 KINESINHEAVY
SMARTiView protein in SMART
SM00129 KISc, 1 hit
SUPFAMiSSF52540 SSF52540, 1 hit
PROSITEiView protein in PROSITE
PS00411 KINESIN_MOTOR_1, 1 hit
PS50067 KINESIN_MOTOR_2, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 11 Publication (identifier: Q9WV63-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MATANFGKIQ IGIYVEIKRS DGRIHQAMVT SLNEDNESVT VEWIENGDTK
60 70 80 90 100
GKEIDLESIF SLNPDLVPDE DIEPSPEIPP PSSSSKVNKI VKNRRTVASI
110 120 130 140 150
KNDPPPRDNR VVGSARARPS QLPEQSSSAQ QNGSVSDISP VQAAKKEFGP
160 170 180 190 200
PSRRKSNCVK EVEKLQEKRE KRRLQQQELR EKRAQDVDAT NPNYEIMCMI
210 220 230 240 250
RDFRGSLDYR PLTTADPIDE HRICVCVRKR PLNKKETQMK DLDVITIPSK
260 270 280 290 300
DVVMVHEPKQ KVDLTRYLEN QTFRFDYAFD DSAPNEMVYR FTARPLVETI
310 320 330 340 350
FERGMATCFA YGQTGSGKTH TMGGDCSGKN QDCSKGIYAL AARDVFLMLK
360 370 380 390 400
KPNYKKLELQ VYATFFEIYS GKVFDLLNRK TKLRVLEDGK QQVQVVGLQE
410 420 430 440 450
REVKCVEDVL KLIDIGNSCR TSGQTSANAH SSRSHAVFQI ILRRKGKLHG
460 470 480 490 500
KFSLIDLAGN ERGADTSSAD RQTRLEGAEI NKSLLALKEC IRALGRNKPH
510 520 530 540 550
TPFRASKLTQ VLRDSFIGEN SRTCMIATIS PGMASCENTL NTLRYANRVK
560 570 580 590 600
ELTVDPTAAG DVRPIMHHPP SQIDDLETQW GVGSSPQRDD LKLLCEQNEE
610 620 630 640 650
EVSPQLFTFH EAVSQMVEME EQVVEDHRAV FQESIRWIED EKALLEMTEE
660 670 680 690 700
VDYDVDSYAT QLEAILEQKI DILTELRDKV KSFRAALQEE EQASKQINPK

RPRAL
Note: Incomplete sequence.Curated
Length:705
Mass (Da):79,792
Last modified:October 2, 2007 - v2
Checksum:i7B6A50DB6B27B6DA
GO
Isoform 21 Publication (identifier: Q9WV63-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     551-551: E → EFGISPSDIPFSQGSGSRPDLSPSYDYDDFSPSITRVKE

Note: Incomplete sequence.Combined sourcesCurated
Show »
Length:743
Mass (Da):83,927
Checksum:i9D1C1C7FAF20493A
GO

Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F1M8L1F1M8L1_RAT
Kinesin-like protein
Kif2a
704Annotation score:

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_052553551E → EFGISPSDIPFSQGSGSRPD LSPSYDYDDFSPSITRVKE in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC105687 Genomic DNA No translation available.
AF155824 mRNA Translation: AAD39241.1
BC091304 mRNA Translation: AAH91304.1
UniGeneiRn.218992

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC105687 Genomic DNA No translation available.
AF155824 mRNA Translation: AAD39241.1
BC091304 mRNA Translation: AAH91304.1
UniGeneiRn.218992

3D structure databases

ProteinModelPortaliQ9WV63
SMRiQ9WV63
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiQ9WV63, 1 interactor

PTM databases

iPTMnetiQ9WV63
PhosphoSitePlusiQ9WV63

Proteomic databases

PRIDEiQ9WV63

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Organism-specific databases

RGDi70974 Kif2a

Phylogenomic databases

HOGENOMiHOG000231329
HOVERGENiHBG003875
InParanoidiQ9WV63
PhylomeDBiQ9WV63

Miscellaneous databases

PROiPR:Q9WV63

Family and domain databases

Gene3Di3.40.850.10, 1 hit
InterProiView protein in InterPro
IPR027640 Kinesin-like_fam
IPR019821 Kinesin_motor_CS
IPR001752 Kinesin_motor_dom
IPR036961 Kinesin_motor_dom_sf
IPR027417 P-loop_NTPase
PANTHERiPTHR24115 PTHR24115, 1 hit
PfamiView protein in Pfam
PF00225 Kinesin, 1 hit
PRINTSiPR00380 KINESINHEAVY
SMARTiView protein in SMART
SM00129 KISc, 1 hit
SUPFAMiSSF52540 SSF52540, 1 hit
PROSITEiView protein in PROSITE
PS00411 KINESIN_MOTOR_1, 1 hit
PS50067 KINESIN_MOTOR_2, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiKIF2A_RAT
AccessioniPrimary (citable) accession number: Q9WV63
Secondary accession number(s): Q5BJW1
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 2, 2007
Last sequence update: October 2, 2007
Last modified: May 23, 2018
This is version 110 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again