Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Due to a server migration, the UniProt 'ID mapping', 'Peptide search' and 'community bibliography submission' tools will not be available on the 19th April 2021 during the morning (EST).

UniProtKB - Q9WTI7 (MYO1C_MOUSE)

Entry version 191 (07 Apr 2021)
Sequence version 2 (14 Apr 2009)
Previous versions | rss
Add a publicationFeedback
Protein

Unconventional myosin-Ic

Gene

Myo1c

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Myosins are actin-based motor molecules with ATPase activity. Unconventional myosins serve in intracellular movements. Their highly divergent tails bind to membranous compartments, which then are moved relative to actin filaments. Involved in glucose transporter recycling in response to insulin by regulating movement of intracellular GLUT4-containing vesicles to the plasma membrane. Component of the hair cell's (the sensory cells of the inner ear) adaptation-motor complex. Acts as a mediator of adaptation of mechanoelectrical transduction in stereocilia of vestibular hair cells. Binds phosphoinositides and links the actin cytoskeleton to cellular membranes.1 Publication
Isoform 3 is involved in regulation of transcription. Associated with transcriptional active ribosomal genes. Appears to cooperate with the WICH chromatin-remodeling complex to facilitate transcription. Necessary for the formation of the first phosphodiester bond during transcription initiation.

Caution

Represents an unconventional myosin. This protein should not be confused with the conventional myosin-1 (MYH1).Curated

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei88ATPBy similarity1
Binding sitei96ATPBy similarity1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi139 – 148ATPBy similarity10
Nucleotide bindingi192 – 196ATPBy similarity5

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActin-binding, Calmodulin-binding, Motor protein, Myosin
Biological processmRNA transport, Protein transport, Translocation, Transport
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-MMU-2029482, Regulation of actin dynamics for phagocytic cup formation
R-MMU-5250924, B-WICH complex positively regulates rRNA expression

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Unconventional myosin-Ic
Alternative name(s):
Myosin I beta
Short name:
MMI-beta
Short name:
MMIb
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Myo1c
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Myomorpha › Muroidea › Muridae › Murinae › Mus › Mus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 11

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...MGIi		MGI:106612, Myo1c

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cell membrane, Cell projection, Cytoplasm, Cytoplasmic vesicle, Membrane, Nuclear pore complex, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi927K → A: Inhibits binding to PIP2 and disrupts membrane binding. 1 Publication1
Mutagenesisi938R → A: Inhibits binding to PIP2 and disrupts membrane binding. 1 Publication1

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001234461 – 1063Unconventional myosin-IcAdd BLAST1063

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei383N6-methyllysineBy similarity1
Modified residuei408PhosphoserineBy similarity1
Modified residuei486N6-acetyllysineCombined sources1
Modified residuei536PhosphoserineBy similarity1
Modified residuei864PhosphoserineBy similarity1
Modified residuei1041PhosphoserineBy similarity1
Isoform 2 (identifier: Q9WTI7-2)
Modified residuei1N-acetylmethionineBy similarity1
Isoform 3 (identifier: Q9WTI7-3)
Modified residuei10PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Isoform 2 contains a N-acetylmethionine at position 1.By similarity

Keywords - PTMi

Acetylation, Methylation, Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q9WTI7

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q9WTI7

PeptideAtlas

More...PeptideAtlasi		Q9WTI7

PRoteomics IDEntifications database

More...PRIDEi		Q9WTI7

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		286126 [Q9WTI7-1]
286127 [Q9WTI7-2]
286128 [Q9WTI7-3]
286129 [Q9WTI7-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q9WTI7

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q9WTI7

SwissPalm database of S-palmitoylation events

More...SwissPalmi		Q9WTI7

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Isoform 3 is expressed in small intestine, pancreas, brain, kidney, skin, heart muscle, testis, striated muscle, spleen, liver and lung (at protein level). Expressed in brain, testis, adrenal glands, thymus, spleen, kidney, lung, heart, cochlea and vestibule. Expressed in sensory hair cells of the inner ear. Expressed in adipocytes.4 Publications

<p>This subsection of the 'Expression' section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Up-regulated by serum.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSMUSG00000017774, Expressed in bone marrow and 303 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q9WTI7, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q9WTI7, MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts (via its IQ motifs) with CALM; this precludes interaction with YWHAB.

Interacts with YWHAB; this precludes interaction with CALM.

Interacts with RPS6 (By similarity).

Interacts with actin filaments.

Interacts (via its IQ motifs) with CABP1 and CIB1; the interaction with CABP1 and CIB1 is calcium-dependent.

Interacts (via tail domain) with PLEKHB1 (via PH domain); the interaction is not affected by the presence or absence of calcium and CALM.

Interacts with POLR1A and POLR2A.

Component of the B-WICH complex, at least composed of SMARCA5/SNF2H, BAZ1B/WSTF, SF3B1, DEK, MYO1C, ERCC6, MYBBP1A and DDX21.

Interacts with GLUT4.

Interacts with LLPH (PubMed:26961175).

By similarity7 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		201664, 147 interactors

ComplexPortal: manually curated resource of macromolecular complexes

More...ComplexPortali		CPX-1133, B-WICH chromatin remodelling complex [Q9WTI7-3]

CORUM comprehensive resource of mammalian protein complexes

More...CORUMi		Q9WTI7

Database of interacting proteins

More...DIPi		DIP-35498N

Protein interaction database and analysis system

More...IntActi		Q9WTI7, 149 interactors

Molecular INTeraction database

More...MINTi		Q9WTI7

STRING: functional protein association networks

More...STRINGi		10090.ENSMUSP00000104069

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q9WTI7, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q9WTI7

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini47 – 731Myosin motorPROSITE-ProRule annotationAdd BLAST685
Domaini734 – 757IQ 1PROSITE-ProRule annotationAdd BLAST24
Domaini758 – 786IQ 2PROSITE-ProRule annotationAdd BLAST29
Domaini885 – 1059TH1PROSITE-ProRule annotationAdd BLAST175

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni608 – 630Actin-bindingPROSITE-ProRule annotationAdd BLAST23

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

Binds directly to large unilamellar vesicles (LUVs) containing phosphatidylinositol 4,5-bisphosphate (PIP2) or inositol 1,4,5-trisphosphate (InsP3). The PIP2-binding site corresponds to the myosin tail domain (PH-like) present in its tail domain.1 Publication

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the TRAFAC class myosin-kinesin ATPase superfamily. Myosin family.Curated

Keywords - Domaini

Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG0164, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000157915

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_000192_7_7_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q9WTI7

Database of Orthologous Groups

More...OrthoDBi		122881at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q9WTI7

TreeFam database of animal gene trees

More...TreeFami		TF312960

Family and domain databases

Conserved Domains Database

More...CDDi		cd01378, MYSc_Myo1, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		3.40.850.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR000048, IQ_motif_EF-hand-BS
IPR036961, Kinesin_motor_dom_sf
IPR001609, Myosin_head_motor_dom
IPR010926, Myosin_TH1
IPR036072, MYSc_Myo1
IPR027417, P-loop_NTPase

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00612, IQ, 2 hits
PF00063, Myosin_head, 1 hit
PF06017, Myosin_TH1, 1 hit

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR00193, MYOSINHEAVY

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00015, IQ, 2 hits
SM00242, MYSc, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF52540, SSF52540, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50096, IQ, 2 hits
PS51456, MYOSIN_MOTOR, 1 hit
PS51757, TH1, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9WTI7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MALQVELIPT GEIIRVVHPH RPCKLALGSD GVRVTMESAL TARDRVGVQD 
        60         70         80         90        100
FVLLENFTSE AAFIENLRRR FRENLIYTYI GPVLVSVNPY RDLQIYSRQH 
       110        120        130        140        150
MERYRGVSFY EVPPHLFAVA DTVYRALRTE RRDQAVMISG ESGAGKTEAT 
       160        170        180        190        200
KRLLQFYAET CPAPERGGAV RDRLLQSNPV LEAFGNAKTL RNDNSSRFGK 
       210        220        230        240        250
YMDVQFDFKG APVGGHILSY LLEKSRVVHQ NHGERNFHVF YQLLEGGEEE 
       260        270        280        290        300
TLRRLGLERN PQSYLYLVKG QCAKVSSIND KSDWKVMRKA LSVIDFTEDE 
       310        320        330        340        350
VEDLLSIVAS VLHLGNIHFA ADEDSNAQVT TENQLKYLTR LLGVEGTTLR 
       360        370        380        390        400
EALTHRKIIA KGEELLSPLN LEQAAYARDA LAKAVYSRTF TWLVRKINRS 
       410        420        430        440        450
LASKDAESPS WRSTTVLGLL DIYGFEVFQH NSFEQFCINY CNEKLQQLFI 
       460        470        480        490        500
ELTLKSEQEE YEAEGIAWEP VQYFNNKIIC DLVEEKFKGI ISILDEECLR 
       510        520        530        540        550
PGEATDLTFL EKLEDTVKPH PHFLTHKLAD QKTRKSLDRG EFRLLHYAGE 
       560        570        580        590        600
VTYSVTGFLD KNNDLLFRNL KETMCSSMNP IMAQCFDKSE LSDKKRPETV 
       610        620        630        640        650
ATQFKMSLLQ LVEILRSKEP AYIRCIKPND AKQPGRFDEV LIRHQVKYLG 
       660        670        680        690        700
LMENLRVRRA GFAYRRKYEA FLQRYKSLCP ETWPMWAGRP QDGVAVLVRH 
       710        720        730        740        750
LGYKPEEYKM GRTKIFIRFP KTLFATEDSL EVRRQSLATK IQAAWRGFHW 
       760        770        780        790        800
RQKFLRVKRS AICIQSWWRG TLGRRKAAKR KWAAQTIRRL IRGFILRHSP 
       810        820        830        840        850
RCPENAFFLD HVRASFLLNL RRQLPRNVLD TSWPTPPPAL REASELLREL 
       860        870        880        890        900
CMKNMVWKYC RSISPEWKQQ LQQKAVASEI FKGKKDNYPQ SVPRLFISTR 
       910        920        930        940        950
LGTEEISPRV LQSLGSEPIQ YAVPVVKYDR KGYKPRPRQL LLTPSAVVIV 
       960        970        980        990       1000
EDAKVKQRID YANLTGISVS SLSDSLFVLH VQREDNKQKG DVVLQSDHVI 
      1010       1020       1030       1040       1050
ETLTKTALSA DRVNNININQ GSITFAGGPG RDGIIDFTSG SELLITKAKN 
      1060 
GHLAVVAPRL NSR
Length:1,063
Mass (Da):121,944
Last modified:April 14, 2009 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i494A31B8634A1AF9
GO
Isoform 2 (identifier: Q9WTI7-2) [UniParc]FASTAAdd to basket
Also known as: A

The sequence of this isoform differs from the canonical sequence as follows:
     1-35: Missing.

Show »
Length:1,028
Mass (Da):118,156
Checksum:i2CF5535D816884DF
GO
Isoform 3 (identifier: Q9WTI7-3) [UniParc]FASTAAdd to basket
Also known as: Nuclear myosin 1, NM1

The sequence of this isoform differs from the canonical sequence as follows:
     1-25: MALQVELIPTGEIIRVVHPHRPCKL → MRYRAS

Show »
Length:1,044
Mass (Da):119,877
Checksum:iCDAB0FF699D041C9
GO
Isoform 4 (identifier: Q9WTI7-4) [UniParc]FASTAAdd to basket
Also known as: B

The sequence of this isoform differs from the canonical sequence as follows:
     932-1063: GYKPRPRQLL...AVVAPRLNSR → VTSLAPGSCCSRPVLWSLWRMLKSSRELIMPT

Note: May be due to a frameshift.Curated
Show »
Length:963
Mass (Da):111,290
Checksum:iC8CEFAE7FADE5B41
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q5ND45Q5ND45_MOUSE
Unconventional myosin-Ic
Myo1c
80Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti69 – 70RR → GG in CAA67956 (PubMed:9119401).Curated2
Sequence conflicti97 – 99SRQ → RRK in CAA67956 (PubMed:9119401).Curated3
Sequence conflicti102E → G in BAE33311 (PubMed:16141072).Curated1
Sequence conflicti107V → I in BAE33311 (PubMed:16141072).Curated1
Sequence conflicti251T → A (PubMed:8449986).Curated1
Sequence conflicti272C → F (PubMed:8449986).Curated1
Sequence conflicti286 – 287VM → LL (PubMed:8449986).Curated2
Sequence conflicti388R → A (PubMed:8449986).Curated1
Sequence conflicti401 – 403LAS → VPA (PubMed:8449986).Curated3
Sequence conflicti446Q → R (PubMed:8449986).Curated1
Sequence conflicti517 – 519VKP → IKH (PubMed:8449986).Curated3
Sequence conflicti578M → T (PubMed:8449986).Curated1
Sequence conflicti607S → G (PubMed:8449986).Curated1
Sequence conflicti735Q → R in CAA67956 (PubMed:9119401).Curated1
Sequence conflicti821R → G in CAA67956 (PubMed:9119401).Curated1
Sequence conflicti842E → D in CAA67956 (PubMed:9119401).Curated1
Sequence conflicti1024T → A in BAE33311 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0368631 – 35Missing in isoform 2. 4 PublicationsAdd BLAST35
Alternative sequenceiVSP_0368641 – 25MALQV…RPCKL → MRYRAS in isoform 3. 2 PublicationsAdd BLAST25
Alternative sequenceiVSP_003350932 – 1063GYKPR…RLNSR → VTSLAPGSCCSRPVLWSLWR MLKSSRELIMPT in isoform 4. 1 PublicationAdd BLAST132

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
U96723 mRNA Translation: AAC53264.1
U96726 Genomic DNA Translation: AAC60758.1
AY007255 mRNA Translation: AAG02570.1
AK004743 mRNA Translation: BAB23524.1
AK154294 mRNA Translation: BAE32495.1
AK155530 mRNA Translation: BAE33311.1
AK171107 mRNA Translation: BAE42253.1
AL591440 Genomic DNA No translation available.
CH466596 Genomic DNA Translation: EDL12832.1
CH466596 Genomic DNA Translation: EDL12833.1
BC021481 mRNA Translation: AAH21481.1
X99638 mRNA Translation: CAA67956.1
CF615767 mRNA No translation available.

The Consensus CDS (CCDS) project

More...CCDSi		CCDS25054.1 [Q9WTI7-2]
CCDS36228.1 [Q9WTI7-3]
CCDS88191.1 [Q9WTI7-1]

Protein sequence database of the Protein Information Resource

More...PIRi		B45438
H75634

NCBI Reference Sequences

More...RefSeqi		NP_001074243.1, NM_001080774.1 [Q9WTI7-2]
NP_001074244.1, NM_001080775.1 [Q9WTI7-3]
NP_032685.1, NM_008659.3 [Q9WTI7-2]
XP_006532492.1, XM_006532429.3

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENSMUST00000069057; ENSMUSP00000070388; ENSMUSG00000017774 [Q9WTI7-2]
ENSMUST00000102504; ENSMUSP00000099562; ENSMUSG00000017774 [Q9WTI7-2]
ENSMUST00000102505; ENSMUSP00000099563; ENSMUSG00000017774 [Q9WTI7-1]
ENSMUST00000108431; ENSMUSP00000104069; ENSMUSG00000017774 [Q9WTI7-3]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		17913

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		mmu:17913

UCSC genome browser

More...UCSCi		uc007kem.1, mouse [Q9WTI7-1]
uc007keo.1, mouse [Q9WTI7-3]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U96723 mRNA Translation: AAC53264.1
U96726 Genomic DNA Translation: AAC60758.1
AY007255 mRNA Translation: AAG02570.1
AK004743 mRNA Translation: BAB23524.1
AK154294 mRNA Translation: BAE32495.1
AK155530 mRNA Translation: BAE33311.1
AK171107 mRNA Translation: BAE42253.1
AL591440 Genomic DNA No translation available.
CH466596 Genomic DNA Translation: EDL12832.1
CH466596 Genomic DNA Translation: EDL12833.1
BC021481 mRNA Translation: AAH21481.1
X99638 mRNA Translation: CAA67956.1
CF615767 mRNA No translation available.
CCDSiCCDS25054.1 [Q9WTI7-2]
CCDS36228.1 [Q9WTI7-3]
CCDS88191.1 [Q9WTI7-1]
PIRiB45438
H75634
RefSeqiNP_001074243.1, NM_001080774.1 [Q9WTI7-2]
NP_001074244.1, NM_001080775.1 [Q9WTI7-3]
NP_032685.1, NM_008659.3 [Q9WTI7-2]
XP_006532492.1, XM_006532429.3

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4R8GX-ray3.50E733-1063[»]
SMRiQ9WTI7
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi201664, 147 interactors
ComplexPortaliCPX-1133, B-WICH chromatin remodelling complex [Q9WTI7-3]
CORUMiQ9WTI7
DIPiDIP-35498N
IntActiQ9WTI7, 149 interactors
MINTiQ9WTI7
STRINGi10090.ENSMUSP00000104069

PTM databases

iPTMnetiQ9WTI7
PhosphoSitePlusiQ9WTI7
SwissPalmiQ9WTI7

Proteomic databases

jPOSTiQ9WTI7
PaxDbiQ9WTI7
PeptideAtlasiQ9WTI7
PRIDEiQ9WTI7
ProteomicsDBi286126 [Q9WTI7-1]
286127 [Q9WTI7-2]
286128 [Q9WTI7-3]
286129 [Q9WTI7-4]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		953, 173 antibodies

Genome annotation databases

EnsembliENSMUST00000069057; ENSMUSP00000070388; ENSMUSG00000017774 [Q9WTI7-2]
ENSMUST00000102504; ENSMUSP00000099562; ENSMUSG00000017774 [Q9WTI7-2]
ENSMUST00000102505; ENSMUSP00000099563; ENSMUSG00000017774 [Q9WTI7-1]
ENSMUST00000108431; ENSMUSP00000104069; ENSMUSG00000017774 [Q9WTI7-3]
GeneIDi17913
KEGGimmu:17913
UCSCiuc007kem.1, mouse [Q9WTI7-1]
uc007keo.1, mouse [Q9WTI7-3]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		4641
MGIiMGI:106612, Myo1c

Phylogenomic databases

eggNOGiKOG0164, Eukaryota
GeneTreeiENSGT00940000157915
HOGENOMiCLU_000192_7_7_1
InParanoidiQ9WTI7
OrthoDBi122881at2759
PhylomeDBiQ9WTI7
TreeFamiTF312960

Enzyme and pathway databases

ReactomeiR-MMU-2029482, Regulation of actin dynamics for phagocytic cup formation
R-MMU-5250924, B-WICH complex positively regulates rRNA expression

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		17913, 2 hits in 53 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		Myo1c, mouse

Protein Ontology

More...PROi		PR:Q9WTI7
RNActiQ9WTI7, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSMUSG00000017774, Expressed in bone marrow and 303 other tissues
ExpressionAtlasiQ9WTI7, baseline and differential
GenevisibleiQ9WTI7, MM

Family and domain databases

CDDicd01378, MYSc_Myo1, 1 hit
Gene3Di3.40.850.10, 1 hit
InterProiView protein in InterPro
IPR000048, IQ_motif_EF-hand-BS
IPR036961, Kinesin_motor_dom_sf
IPR001609, Myosin_head_motor_dom
IPR010926, Myosin_TH1
IPR036072, MYSc_Myo1
IPR027417, P-loop_NTPase
PfamiView protein in Pfam
PF00612, IQ, 2 hits
PF00063, Myosin_head, 1 hit
PF06017, Myosin_TH1, 1 hit
PRINTSiPR00193, MYOSINHEAVY
SMARTiView protein in SMART
SM00015, IQ, 2 hits
SM00242, MYSc, 1 hit
SUPFAMiSSF52540, SSF52540, 1 hit
PROSITEiView protein in PROSITE
PS50096, IQ, 2 hits
PS51456, MYOSIN_MOTOR, 1 hit
PS51757, TH1, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMYO1C_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9WTI7
Secondary accession number(s): O08571
, O08834, Q3TBQ4, Q3U231, Q5ND46, Q5ND48, Q5ND49, Q9ERB6, Q9QW54
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 27, 2001
Last sequence update: April 14, 2009
Last modified: April 7, 2021
This is version 191 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again