Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Due to a server migration, the UniProt 'ID mapping', 'Peptide search' and 'community bibliography submission' tools will not be available on the 19th April 2021 during the morning (EST).

UniProtKB - Q9W0G1 (PTP61_DROME)

Entry version 168 (02 Dec 2020)
Sequence version 1 (01 May 2000)
Previous versions | rss
Add a publicationFeedback
Protein

Tyrosine-protein phosphatase non-receptor type 61F

Gene

Ptp61F

Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Non-receptor protein tyrosine phosphatase required for maintaining Dock in its non-phosphorylated state.2 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei203SubstrateBy similarity1
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei237Phosphocysteine intermediatePROSITE-ProRule annotationBy similarity1
Binding sitei281SubstrateBy similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase, Protein phosphatase

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-DME-210688, Dephosphorylation by PTP61F phosphatases [Q9W0G1-1]
R-DME-210693, STAT92E dimer dephosphorylated in the nucleus and transported to the cytosol [Q9W0G1-2]
R-DME-877312, Regulation of IFNG signaling [Q9W0G1-2]
R-DME-8849472, PTK6 Down-Regulation [Q9W0G1-2]

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Tyrosine-protein phosphatase non-receptor type 61F (EC:3.1.3.48)
Alternative name(s):
dPTP61F
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Ptp61F
ORF Names:CG9181
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiDrosophila melanogaster (Fruit fly)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri7227 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Ecdysozoa › Arthropoda › Hexapoda › Insecta › Pterygota › Neoptera › Holometabola › Diptera › Brachycera › Muscomorpha › Ephydroidea › Drosophilidae › Drosophila › Sophophora ›
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000803 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 3L

Organism-specific databases

Drosophila genome database

More...FlyBasei		FBgn0267487, Ptp61F

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cytoplasm, Membrane, Nucleus

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000948531 – 548Tyrosine-protein phosphatase non-receptor type 61FAdd BLAST548

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei83Phosphoserine1 Publication1
Modified residuei86Phosphotyrosine1 Publication1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q9W0G1

PRoteomics IDEntifications database

More...PRIDEi		Q9W0G1

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q9W0G1

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed during oogenesis and embryogenesis. Isoform A and isoform B are expressed in distinct patterns. Isoform B is expressed in the mesoderm and neuroblast layer during germband extension and later in the gut epithelia. Isoform A accumulates in 16 segmentally repeated stripes in the ectoderm during germband extension. These stripes are flanked by, and adjacent to, the domains of engrailed and wingless gene expression in the anterior/posterior axis. In stage 10 embryos, isoform A colocalizes with the area lateral to the denticle belts that will give rise to naked cuticle. Isoform A is also expressed later in embryogenesis in the central nervous system.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		FBgn0267487, Expressed in egg cell and 46 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q9W0G1, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q9W0G1, DM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		63702, 20 interactors

Protein interaction database and analysis system

More...IntActi		Q9W0G1, 5 interactors

STRING: functional protein association networks

More...STRINGi		7227.FBpp0072602

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q9W0G1

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini33 – 296Tyrosine-protein phosphatasePROSITE-ProRule annotationAdd BLAST264

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni237 – 243Substrate bindingBy similarity7

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the protein-tyrosine phosphatase family. Non-receptor class 1 subfamily.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG0789, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000154686

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q9W0G1

Identification of Orthologs from Complete Genome Data

More...OMAi		CETYQNF

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q9W0G1

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		3.90.190.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR029021, Prot-tyrosine_phosphatase-like
IPR000242, PTPase_domain
IPR016130, Tyr_Pase_AS
IPR003595, Tyr_Pase_cat
IPR000387, TYR_PHOSPHATASE_dom

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00102, Y_phosphatase, 1 hit

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR00700, PRTYPHPHTASE

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00194, PTPc, 1 hit
SM00404, PTPc_motif, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF52799, SSF52799, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS00383, TYR_PHOSPHATASE_1, 1 hit
PS50056, TYR_PHOSPHATASE_2, 1 hit
PS50055, TYR_PHOSPHATASE_PTP, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform A1 Publication (identifier: Q9W0G1-1) [UniParc]FASTAAdd to basket
Also known as: Cytoplasmic1 Publication, DPTP61Fm

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSEQKTSGSG SAAAARLQIE AEYKDKGPQW HRFYKEICET CDREAKEKQF 
        60         70         80         90        100
STSESERHTN RGLNRYRDVN PYDHSRIVLK RGSVDYINAN LVQLERAERQ 
       110        120        130        140        150
YILTQGPLVD TVGHFWLMVW EQKSRAVLML NKLMEKKQIK CHLYWPNEMG 
       160        170        180        190        200
ADKALKLPHV KLTVELVRLE TYQNFVRRWF KLTDLETQQS REVMQFHYTT 
       210        220        230        240        250
WPDFGIPSSP NAFLKFLQQV RDSGCLSRDV GPAVVHCSAG IGRSGTFCLV 
       260        270        280        290        300
DCCLVLIDKY GECNVSKVLC ELRSYRMGLI QTADQLDFSY QAIIEGIKKL 
       310        320        330        340        350
HDPTFLDAEE PLISNDTETH TLDELPPPLP PRVQSLNLPL APNSGGILSL 
       360        370        380        390        400
NMRAAQANGA ESIGKELSKD ALNNFINQHD MIHDAEVADS RPLPPLPVRA 
       410        420        430        440        450
FNDSDSDEDY LLDDDDEDDT DEDEEYETIN EHDADPVNGH VPATTQPHAD 
       460        470        480        490        500
DVNANNEKPA VPVDEQHKAN GIDPIPGQLP ASPENELKRR KRNEYQASLE 
       510        520        530        540 
QKVNDMKRKQ RENEDKQLAA KKRRSLLTYI AAGVVVGVIC AYAYTKLG
Length:548
Mass (Da):62,105
Last modified:May 1, 2000 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iC6AF630E2DE3F11C
GO
Isoform B1 Publication (identifier: Q9W0G1-2) [UniParc]FASTAAdd to basket
Also known as: Nuclear1 Publication, DPTP61Fn

The sequence of this isoform differs from the canonical sequence as follows:
     525-548: SLLTYIAAGVVVGVICAYAYTKLG → RGNRLKKSKTK

Show »
Length:535
Mass (Da):60,974
Checksum:iD80C8CD1AC99AF60
GO
Isoform C1 Publication (identifier: Q9W0G1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-34: MSEQKTSGSGSAAAARLQIEAEYKDKGPQWHRFY → MTKFAQRSKKTCEIRGTMDVCVCVCVSMW
     525-548: SLLTYIAAGVVVGVICAYAYTKLG → RGNRLKKSKTK

Show »
Length:530
Mass (Da):60,487
Checksum:i1EF64FCDF6AA177E
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q8IRH4Q8IRH4_DROME
Protein tyrosine phosphatase 61F, i...
Ptp61F anon-WO0118547.297, anon-WO0140519.98, BEST:LP01280, CG9178, CPtp62A
431Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti274S → T (PubMed:8463208).Curated1
Sequence conflicti274S → T (Ref. 2) Curated1
Sequence conflicti382I → F in AAA75348 (PubMed:8463208).Curated1
Sequence conflicti382I → F in AAA75349 (PubMed:8463208).Curated1
Sequence conflicti382I → F in AAA75338 (PubMed:8463208).Curated1
Sequence conflicti382I → F in AAA75339 (PubMed:8463208).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0507331 – 34MSEQK…WHRFY → MTKFAQRSKKTCEIRGTMDV CVCVCVSMW in isoform C. 2 PublicationsAdd BLAST34
Alternative sequenceiVSP_050259525 – 548SLLTY…YTKLG → RGNRLKKSKTK in isoform B and isoform C. 2 PublicationsAdd BLAST24

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
L11250, L11249 Genomic DNA Translation: AAA75348.1
L11251, L11249, L11250 Genomic DNA Translation: AAA75349.1
L11252 mRNA Translation: AAA75338.1
L11253 mRNA Translation: AAA75339.1
L14849 mRNA Translation: AAA28748.1
AE014296 Genomic DNA Translation: AAF47486.1
AE014296 Genomic DNA Translation: AAF47487.1
AE014296 Genomic DNA Translation: AAN11475.1
AY069713 mRNA Translation: AAL39858.1

Protein sequence database of the Protein Information Resource

More...PIRi		A46101
B46101

NCBI Reference Sequences

More...RefSeqi		NP_476687.1, NM_057339.5 [Q9W0G1-1]
NP_476688.1, NM_057340.4 [Q9W0G1-2]
NP_728600.1, NM_167874.2 [Q9W0G1-3]

Genome annotation databases

Ensembl metazoan genome annotation project

More...EnsemblMetazoai		FBtr0072716; FBpp0072600; FBgn0267487 [Q9W0G1-3]
FBtr0072717; FBpp0072601; FBgn0267487 [Q9W0G1-2]
FBtr0072718; FBpp0072602; FBgn0267487 [Q9W0G1-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		38160

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		dme:Dmel_CG9181

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L11250, L11249 Genomic DNA Translation: AAA75348.1
L11251, L11249, L11250 Genomic DNA Translation: AAA75349.1
L11252 mRNA Translation: AAA75338.1
L11253 mRNA Translation: AAA75339.1
L14849 mRNA Translation: AAA28748.1
AE014296 Genomic DNA Translation: AAF47486.1
AE014296 Genomic DNA Translation: AAF47487.1
AE014296 Genomic DNA Translation: AAN11475.1
AY069713 mRNA Translation: AAL39858.1
PIRiA46101
B46101
RefSeqiNP_476687.1, NM_057339.5 [Q9W0G1-1]
NP_476688.1, NM_057340.4 [Q9W0G1-2]
NP_728600.1, NM_167874.2 [Q9W0G1-3]

3D structure databases

SMRiQ9W0G1
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi63702, 20 interactors
IntActiQ9W0G1, 5 interactors
STRINGi7227.FBpp0072602

PTM databases

iPTMnetiQ9W0G1

Proteomic databases

PaxDbiQ9W0G1
PRIDEiQ9W0G1

Genome annotation databases

EnsemblMetazoaiFBtr0072716; FBpp0072600; FBgn0267487 [Q9W0G1-3]
FBtr0072717; FBpp0072601; FBgn0267487 [Q9W0G1-2]
FBtr0072718; FBpp0072602; FBgn0267487 [Q9W0G1-1]
GeneIDi38160
KEGGidme:Dmel_CG9181

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		38160
FlyBaseiFBgn0267487, Ptp61F

Phylogenomic databases

eggNOGiKOG0789, Eukaryota
GeneTreeiENSGT00940000154686
InParanoidiQ9W0G1
OMAiCETYQNF
PhylomeDBiQ9W0G1

Enzyme and pathway databases

ReactomeiR-DME-210688, Dephosphorylation by PTP61F phosphatases [Q9W0G1-1]
R-DME-210693, STAT92E dimer dephosphorylated in the nucleus and transported to the cytosol [Q9W0G1-2]
R-DME-877312, Regulation of IFNG signaling [Q9W0G1-2]
R-DME-8849472, PTK6 Down-Regulation [Q9W0G1-2]

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		38160, 0 hits in 3 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		Ptp61F, fly

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		38160

Protein Ontology

More...PROi		PR:Q9W0G1

Gene expression databases

BgeeiFBgn0267487, Expressed in egg cell and 46 other tissues
ExpressionAtlasiQ9W0G1, baseline and differential
GenevisibleiQ9W0G1, DM

Family and domain databases

Gene3Di3.90.190.10, 1 hit
InterProiView protein in InterPro
IPR029021, Prot-tyrosine_phosphatase-like
IPR000242, PTPase_domain
IPR016130, Tyr_Pase_AS
IPR003595, Tyr_Pase_cat
IPR000387, TYR_PHOSPHATASE_dom
PfamiView protein in Pfam
PF00102, Y_phosphatase, 1 hit
PRINTSiPR00700, PRTYPHPHTASE
SMARTiView protein in SMART
SM00194, PTPc, 1 hit
SM00404, PTPc_motif, 1 hit
SUPFAMiSSF52799, SSF52799, 1 hit
PROSITEiView protein in PROSITE
PS00383, TYR_PHOSPHATASE_1, 1 hit
PS50056, TYR_PHOSPHATASE_2, 1 hit
PS50055, TYR_PHOSPHATASE_PTP, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPTP61_DROME
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9W0G1
Secondary accession number(s): Q27932, Q8SZY3, Q9W0G2
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 10, 2004
Last sequence update: May 1, 2000
Last modified: December 2, 2020
This is version 168 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Drosophila
    Drosophila: entries, gene names and cross-references to FlyBase
  2. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again