Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 125 (13 Nov 2019)
Sequence version 2 (01 Oct 2002)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Cytosolic carboxypeptidase Nna1

Gene

Nna1

Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Metallocarboxypeptidase.By similarity

<p>This subsection of the ‘Function’ section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Zn2+By similarityNote: Binds 1 zinc ion per subunit.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the ‘Description’ field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi938ZincBy similarity1
Metal bindingi941ZincBy similarity1
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei988NucleophileBy similarity1
Metal bindingi1034ZincBy similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionCarboxypeptidase, Hydrolase, Metalloprotease, Protease
LigandMetal-binding, Zinc

Protein family/group databases

MEROPS protease database

More...
MEROPSi
M14.A21

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Cytosolic carboxypeptidase Nna1Curated (EC:3.4.17.-)
Alternative name(s):
Nervous system nuclear protein induced by axotomy protein 1 homolog
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Nna1Imported
Synonyms:NnaD1 Publication
ORF Names:CG44533Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiDrosophila melanogaster (Fruit fly)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri7227 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraHolometabolaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000803 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome X

Organism-specific databases

Drosophila genome database

More...
FlyBasei
FBgn0265726 Nna1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Mitochondrion

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

Semilethal phenotype: females survive, while males die. Most male flies die between the late second instar larval stage and early pupal stage. Mutant males that survive to produce pupal cases initiate morphogenesis but die before head eversion. Almost all male flies that survive past head eversion do complete morphogenesis, and then eclose as 'escaper' males. Escapers display a range of phenotypes that mirror the disease pathology observed in pcd mice, including retinal degeneration.1 Publication

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00004037651 – 1201Cytosolic carboxypeptidase Nna1Add BLAST1201

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9VY99

PRoteomics IDEntifications database

More...
PRIDEi
Q9VY99

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

In larvae, highly expressed in the brain, optic lobes, and ventral ganglia.1 Publication

<p>This subsection of the ‘Expression’ section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified ‘at the protein level’.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Expressed in larvae and adults.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
FBgn0265726 Expressed in 17 organ(s), highest expression level in adult organism

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9VY99 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9VY99 DM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
58706, 2 interactors

Protein interaction database and analysis system

More...
IntActi
Q9VY99, 1 interactor

STRING: functional protein association networks

More...
STRINGi
7227.FBpp0073644

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the peptidase M14 family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3641 Eukaryota
COG2866 LUCA

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9VY99

KEGG Orthology (KO)

More...
KOi
K23437

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9VY99

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR040626 Pepdidase_M14_N
IPR000834 Peptidase_M14

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF18027 Pepdidase_M14_N, 1 hit
PF00246 Peptidase_M14, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform A (identifier: Q9VY99-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAEREREAMS ASLSRLLRTL SSASMSRRHC PLALLQPIPL HQSEIALGSA
60 70 80 90 100
SSGGSAERCC SSCSDDSNNN ERCKSAERGT AADEVGEEGR EEVELESKED
110 120 130 140 150
AVEGEQDELE LKRDSSTVNV NVVRANFKCN DMECSLVLGD YVNGFLGSFL
160 170 180 190 200
SKGLKTNQLV VNTDEKTLRP VARLKEPRDL FALPKDKDND CSQQAPRWPV
210 220 230 240 250
ECQVIEERII HIPYVPAVPE PLNAPTGNEL KPRPVGEENG IVVFSYSPIS
260 270 280 290 300
AVNYEKPKAK KEDDESSDES DYSSDSRQDS TPPSRSTPMR LAGGGECAPG
310 320 330 340 350
KLNSVSKMIN NVDNRSTSAS LDDNDDYYDD EYDTSGGYCG GSGEAKEKAI
360 370 380 390 400
IKDLIEAKKK RYQEEAEVTP VGGGTARNSR AASRSEASKD ASDIDDIWKN
410 420 430 440 450
NTSEYKPASP RYVLSQFGKN VTKAVIDRIV DHEDLVPPSG SQKVSNQFAV
460 470 480 490 500
GPVKLPKTNI ARLEVAFERS ACQDRSKSRL KKKMSSSRRR RESTSDEDSS
510 520 530 540 550
SSSLGNEEDE EVDDSDSDAE NTGSGIGLRR ILGSYSARLA GGAEKCPCPG
560 570 580 590 600
SGSVSDTETL VGDESRSRLA GSNGLHQQDV VCSRNRQAQS RSPLRSVPHT
610 620 630 640 650
HAATVAAAAA ALARGRNRDK DGCLGGKDEK NMGMGVGTTG TSSMGTRTSS
660 670 680 690 700
PVRNNVFRLS KDQHILLNSM TSQETTGTLI SSTSTNQTTT TTNSSQSFLC
710 720 730 740 750
SDLPQAQFSR SAVGGARFMT NCHPMNPEEY DGLEFESRFE SGNLAKAVQI
760 770 780 790 800
TPTYYELYLR PDLYTSRSKQ WFYFRVRRTR RKMLYRFSIV NLVKSDSLYN
810 820 830 840 850
DGMQPVMYST LGAKEKSEGW RRCGDNICYY RNDDESASSS ANEDDEDNST
860 870 880 890 900
YTLTFTIEFE HDDDTVFFAH SYPYTYSDLQ DYLMEIQRHP VKSKFCKLRL
910 920 930 940 950
LCRTLAGNNV YYLTVTAPSS NEENMRRKKS IVVSARVHPS ETPASWMMKG
960 970 980 990 1000
LMDFITGDTT VAKRLRHKFI FKLVPMLNPD GVIVGNTRNS LTGKDLNRQY
1010 1020 1030 1040 1050
RTVIRETYPS IWYTKAMIRR LIEECGVAMY CDMHAHSRKH NIFIYGCENK
1060 1070 1080 1090 1100
RNPEKKLTEQ VFPLMLHKNS ADRFSFESCK FKIQRSKEGT GRIVVWMLGI
1110 1120 1130 1140 1150
TNSYTIEASF GGSSLGSRKG THFNTQDYEH MGRAFCETLL DYCDENPNKV
1160 1170 1180 1190 1200
KRHAKLFKQI KKIRKREKRE QKALKLQKMA DQGCIMNDKL KVKRSVEKSV

S
Length:1,201
Mass (Da):133,999
Last modified:October 1, 2002 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iAC52F081324B879B
GO
Isoform B (identifier: Q9VY99-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     444-707: Missing.

Show »
Length:937
Mass (Da):106,067
Checksum:i8CF980447A7EC1FF
GO
Isoform C (identifier: Q9VY99-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-288: Missing.

Note: No experimental confirmation available.
Show »
Length:913
Mass (Da):102,355
Checksum:iE729ECE6A765902B
GO
Isoform D (identifier: Q9VY99-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-143: MAEREREAMS...CSLVLGDYVN → MDFGGGRVQFLQAQLFPVCTLTTSSG

Note: No experimental confirmation available.
Show »
Length:1,084
Mass (Da):121,217
Checksum:iF730F603000395CD
GO
Isoform E (identifier: Q9VY99-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-143: MAEREREAMS...CSLVLGDYVN → MQKGVKDKENRNSAMGPEICEVQQHPSKQND
     1183-1201: GCIMNDKLKVKRSVEKSVS → ILNLLKQQDR...SRTLSTGAPK

Note: No experimental confirmation available.
Show »
Length:1,923
Mass (Da):212,107
Checksum:i4922E6D9DE555FDB
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
X2JBR4X2JBR4_DROME
Nna1 carboxypeptidase, isoform H
Nna1 CG11428, CG32627, CG32628, Dmel\CG44533, NnaD
1,890Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M9NEF7M9NEF7_DROME
Nna1 carboxypeptidase, isoform F
Nna1 CG11428, CG32627, CG32628, Dmel\CG44533, NnaD
913Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M9NF40M9NF40_DROME
Nna1 carboxypeptidase, isoform G
Nna1 CG11428, CG32627, CG32628, Dmel\CG44533, NnaD
748Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M9NGD4M9NGD4_DROME
Nna1 carboxypeptidase, isoform E
Nna1 CG11428, CG32627, CG32628, Dmel\CG44533, NnaD
1,089Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
X2JDN6X2JDN6_DROME
Nna1 carboxypeptidase, isoform I
Nna1 CG11428, CG32627, CG32628, Dmel\CG44533, NnaD
1,889Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
X2JK43X2JK43_DROME
Nna1 carboxypeptidase, isoform J
Nna1 CG11428, CG32627, CG32628, Dmel\CG44533, NnaD
1,694Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0404391 – 288Missing in isoform C. CuratedAdd BLAST288
Alternative sequenceiVSP_0404401 – 143MAERE…GDYVN → MDFGGGRVQFLQAQLFPVCT LTTSSG in isoform D. CuratedAdd BLAST143
Alternative sequenceiVSP_0404411 – 143MAERE…GDYVN → MQKGVKDKENRNSAMGPEIC EVQQHPSKQND in isoform E. CuratedAdd BLAST143
Alternative sequenceiVSP_040442444 – 707Missing in isoform B. 1 PublicationAdd BLAST264
Alternative sequenceiVSP_0404431183 – 1201GCIMN…EKSVS → ILNLLKQQDRLRSKIIERLM REGSSADEPLNIPLSDYSSD EGNCSSSSDNEGKHSITTSD LEGPCCAPTRAPPSSPEVIH EIRKFRMRRMRKVMHELDRI YFTPLFQRKFKTLTTLKRRR QKMGVKAAPSGKRLRGGGGP AVSAATPTPAPAVQAAAPVV ETNDVQKLHTPRQLARSLPS NSDQPTGGQSSDSSESMDSS QSESLLEPDGSSGSTAASKE VTKKVKTSGAGTKKTAKKKK FMPTEKKKPVVNQKLHVDRN FRLWLANRRIYIYRRKKSTQ ARRTKVRNKPSKKRGEVVRT TLDLPTTDPGSDLHFSTDDE EHSPTSGHNGYGAVPPLRHT LLQSDLQRRYIEEIGDTVVQ KPKASHMPPELIVTTPSKSG TPGGGKKLDVYKLTPRTAPE LDTGIGMMQRQAGGTGTSAR RTYSWHNLDQQEIPNGNGGG QGKANFYIGDTKPGIKTMAK PLPRRSVPSNFIPQRHGNVQ TADDLQLKLSLKKKVWTGAN GDADGRPLAWYKGHSITASQ MANTTTTIRSAGGGAAGGGG AGAGAGAGGGGGGQNRNMFP SNGREQTAASGGIAMGVPPA FVGAPRRFRKLEQVDLFNAC SQKLMMWQQQEEQRRSHPQQ AQRLLKVEDHPQHSRDREQQ PFKPMHVVRKSTGTTSQAKV IQALVAAESGGKVKRKSSSM MKIAETTQLVTRFARNRNSA GGSAAQQQQQQQPPQHMHHQ HKRLLFKGQGGVGAMGSRMH SAGVMGNMQGNGGGRAPNKF KTGGLVITAVQQPTNMTGGG SRRMRNAAGLQAKGSNGALG SSTGQMQYQRSNASVQANKS ATEISMDAVSLVRKVKTKLK KRKSRTLSTGAPK in isoform E. CuratedAdd BLAST19

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AE014298 Genomic DNA Translation: AAF48304.2
AE014298 Genomic DNA Translation: AAN09334.1
AE014298 Genomic DNA Translation: AAO41651.1
AE014298 Genomic DNA Translation: ABW09409.1
AY069812 mRNA Translation: AAL39957.1
BT099687 mRNA Translation: ACV44473.1

NCBI Reference Sequences

More...
RefSeqi
NP_001096975.1, NM_001103505.3 [Q9VY99-4]
NP_001245656.1, NM_001258727.1 [Q9VY99-3]
NP_572914.2, NM_132686.3 [Q9VY99-1]
NP_727728.1, NM_167379.2 [Q9VY99-2]
NP_788899.1, NM_176726.2 [Q9VY99-3]

Genome annotation databases

Ensembl metazoan genome annotation project

More...
EnsemblMetazoai
FBtr0340671; FBpp0309513; FBgn0265726 [Q9VY99-1]
FBtr0340672; FBpp0309514; FBgn0265726 [Q9VY99-2]
FBtr0340673; FBpp0309515; FBgn0265726 [Q9VY99-3]
FBtr0340674; FBpp0309516; FBgn0265726 [Q9VY99-4]
FBtr0340676; FBpp0309518; FBgn0265726 [Q9VY99-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
32329

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
dme:Dmel_CG44533

UCSC genome browser

More...
UCSCi
CG32627-RA d. melanogaster [Q9VY99-1]
CG32627-RB d. melanogaster
CG32627-RC d. melanogaster
CG32627-RD d. melanogaster

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AE014298 Genomic DNA Translation: AAF48304.2
AE014298 Genomic DNA Translation: AAN09334.1
AE014298 Genomic DNA Translation: AAO41651.1
AE014298 Genomic DNA Translation: ABW09409.1
AY069812 mRNA Translation: AAL39957.1
BT099687 mRNA Translation: ACV44473.1
RefSeqiNP_001096975.1, NM_001103505.3 [Q9VY99-4]
NP_001245656.1, NM_001258727.1 [Q9VY99-3]
NP_572914.2, NM_132686.3 [Q9VY99-1]
NP_727728.1, NM_167379.2 [Q9VY99-2]
NP_788899.1, NM_176726.2 [Q9VY99-3]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGridi58706, 2 interactors
IntActiQ9VY99, 1 interactor
STRINGi7227.FBpp0073644

Protein family/group databases

MEROPSiM14.A21

Proteomic databases

PaxDbiQ9VY99
PRIDEiQ9VY99

Genome annotation databases

EnsemblMetazoaiFBtr0340671; FBpp0309513; FBgn0265726 [Q9VY99-1]
FBtr0340672; FBpp0309514; FBgn0265726 [Q9VY99-2]
FBtr0340673; FBpp0309515; FBgn0265726 [Q9VY99-3]
FBtr0340674; FBpp0309516; FBgn0265726 [Q9VY99-4]
FBtr0340676; FBpp0309518; FBgn0265726 [Q9VY99-3]
GeneIDi32329
KEGGidme:Dmel_CG44533
UCSCiCG32627-RA d. melanogaster [Q9VY99-1]
CG32627-RB d. melanogaster
CG32627-RC d. melanogaster
CG32627-RD d. melanogaster

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
32329
FlyBaseiFBgn0265726 Nna1

Phylogenomic databases

eggNOGiKOG3641 Eukaryota
COG2866 LUCA
InParanoidiQ9VY99
KOiK23437
PhylomeDBiQ9VY99

Miscellaneous databases

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
32329

Protein Ontology

More...
PROi
PR:Q9VY99

Gene expression databases

BgeeiFBgn0265726 Expressed in 17 organ(s), highest expression level in adult organism
ExpressionAtlasiQ9VY99 baseline and differential
GenevisibleiQ9VY99 DM

Family and domain databases

InterProiView protein in InterPro
IPR040626 Pepdidase_M14_N
IPR000834 Peptidase_M14
PfamiView protein in Pfam
PF18027 Pepdidase_M14_N, 1 hit
PF00246 Peptidase_M14, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiNNAD_DROME
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9VY99
Secondary accession number(s): A8JUW0
, C7LAD7, Q86B56, Q8T9D7
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 11, 2011
Last sequence update: October 1, 2002
Last modified: November 13, 2019
This is version 125 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Peptidase families
    Classification of peptidase families and list of entries
  2. SIMILARITY comments
    Index of protein domains and families
  3. Drosophila
    Drosophila: entries, gene names and cross-references to FlyBase
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again