Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 157 (02 Jun 2021)
Sequence version 1 (01 May 2000)
Previous versions | rss
Add a publicationFeedback
Protein

Cyclic AMP response element-binding protein B

Gene

CrebB

Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Isoform E is a PKA-dependent transcriptional activator. Isoform J is a direct antagonist of activation by isoform E in cell culture. Binds the cAMP response element (CRE) (consensus: 5'-GTGACGT[AC][AG]-3'), a sequence present in many viral and cellular promoters (PubMed:7651429, PubMed:15219829).

Has a role in long-term memory (PubMed:29473541).

3 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActivator, DNA-binding
Biological processTranscription, Transcription regulation

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-DME-198693, AKT phosphorylates targets in the nucleus
R-DME-199920, CREB phosphorylation
R-DME-375165, NCAM signaling for neurite out-growth
R-DME-442742, CREB1 phosphorylation through NMDA receptor-mediated activation of RAS signaling
R-DME-881907, Gastrin-CREB signalling pathway via PKC and MAPK
R-DME-9634638, Estrogen-dependent nuclear events downstream of ESR-membrane signaling

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
Q9VWW0

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Cyclic AMP response element-binding protein B
Short name:
cAMP response element-binding protein B
Short name:
dCREB-B
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CrebBImported
Synonyms:CrebB-17AImported
ORF Names:CG6103
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiDrosophila melanogaster (Fruit fly)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri7227 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraEndopterygotaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000803 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome X

Organism-specific databases

Drosophila genome database

More...
FlyBasei
FBgn0265784, CrebB

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

RNAi-mediated knockdown in the mushroom bodies results in a reduction in long-term memory performance, but does not affect anesthesia-resistant memory (ARM) or learning ability.1 Publication

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi328L → V: Fails to block PKA-dependent activation by isoform E; in isoform G. 1 Publication1
Mutagenesisi335L → V: Fails to block PKA-dependent activation by isoform E; in isoform G. 1 Publication1

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000766361 – 359Cyclic AMP response element-binding protein BAdd BLAST359

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei209PhosphoserinePROSITE-ProRule annotation1 Publication1
Modified residuei212PhosphoserinePROSITE-ProRule annotation1 Publication1
Modified residuei214PhosphoserinePROSITE-ProRule annotation1 Publication1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9VWW0

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9VWW0

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Most cells of the adult brain; cell bodies, but not neuropil.1 Publication

<p>This subsection of the 'Expression' section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified 'at the protein level'.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Throughout development with lowest levels in first larval instar and late pupae.3 Publications

Gene expression databases

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9VWW0, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9VWW0, DM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer.

1 Publication

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
59134, 31 interactors

Protein interaction database and analysis system

More...
IntActi
Q9VWW0, 15 interactors

STRING: functional protein association networks

More...
STRINGi
7227.FBpp0074326

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9VWW0

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini198 – 257KIDPROSITE-ProRule annotationAdd BLAST60
Domaini300 – 359bZIPPROSITE-ProRule annotationAdd BLAST60

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 73DisorderedSequence analysisAdd BLAST73
Regioni185 – 238DisorderedSequence analysisAdd BLAST54
Regioni301 – 326Basic motifPROSITE-ProRule annotationAdd BLAST26
Regioni328 – 349Leucine-zipperPROSITE-ProRule annotationAdd BLAST22

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi1 – 23Polar residuesSequence analysisAdd BLAST23
Compositional biasi45 – 73Polar residuesSequence analysisAdd BLAST29
Compositional biasi201 – 228Basic and acidic residuesSequence analysisAdd BLAST28

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the bZIP family. ATF subfamily.Sequence analysis

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3584, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000173530

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9VWW0

Identification of Orthologs from Complete Genome Data

More...
OMAi
NMDNSIV

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9VWW0

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR004827, bZIP
IPR003102, Coactivator_CBP_pKID
IPR001630, Leuzip_CREB

The PANTHER Classification System

More...
PANTHERi
PTHR45879, PTHR45879, 2 hits

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00170, bZIP_1, 1 hit
PF02173, pKID, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00338, BRLZ, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50217, BZIP, 1 hit
PS00036, BZIP_BASIC, 1 hit
PS50953, KID, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform E1 Publication (identifier: Q9VWW0-1) [UniParc]FASTAAdd to basket
Also known as: dCREB2-a1 Publication

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDNSIVEENG NSSAASGSND VVDVVAQQAA AAVGGGGGGG GGGGGGNPQQ
60 70 80 90 100
QQQNPQSTTA GGPTGATNNA QGGGVSSVLT TTANCNIQYP IQTLAQHGLQ
110 120 130 140 150
VSIWGPGAWC QLSSVRCYGS QPEVATKDVQ SVIQANPSGV IQTAAGTQQQ
160 170 180 190 200
QQALAAATAM QKVVYVAKPP NSTVIHTTPG NAVQVRNKIP PTFPCKIKPE
210 220 230 240 250
PNTQHPEDSD ESLSDDDSQH HRSELTRRPS YNKIFTEISG PDMSGASLPM
260 270 280 290 300
SDGVLNSQLA GTGAGGNAAN SSLMQLDPTY YLSNRMSYNT NNSGIAEDQT
310 320 330 340 350
RKREIRLQKN REAARECRRK KKEYIKCLEN RVAVLENQNK ALIEELKSLK

ELYCQTKND
Length:359
Mass (Da):37,939
Last modified:May 1, 2000 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i382CDE11C43BFB45
GO
Isoform D1 Publication (identifier: Q9VWW0-3) [UniParc]FASTAAdd to basket
Also known as: dCREB2-d1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     101-128: Missing.

Show »
Length:331
Mass (Da):34,931
Checksum:iBE1AB52683AD3FCF
GO
Isoform F1 Publication (identifier: Q9VWW0-4) [UniParc]FASTAAdd to basket
Also known as: dCREB2-c1 Publication, H

The sequence of this isoform differs from the canonical sequence as follows:
     101-128: Missing.
     245-291: GASLPMSDGVLNSQLAGTGAGGNAANSSLMQLDPTYYLSNRMSYNTN → D

Show »
Length:285
Mass (Da):30,253
Checksum:i2A7ADF6FF14CEEC6
GO
Isoform G (identifier: Q9VWW0-2) [UniParc]FASTAAdd to basket
Also known as: dCREB2-e1 Publication, I

The sequence of this isoform differs from the canonical sequence as follows:
     101-128: Missing.
     185-188: Missing.

Note: Isolated from Schneider 2 cells.Curated
Show »
Length:327
Mass (Da):34,434
Checksum:iDBCF416103EC7C87
GO
Isoform J (identifier: Q9VWW0-5) [UniParc]FASTAAdd to basket
Also known as: dCREB2-b1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     101-128: Missing.
     185-188: Missing.
     245-291: GASLPMSDGVLNSQLAGTGAGGNAANSSLMQLDPTYYLSNRMSYNTN → D

Show »
Length:281
Mass (Da):29,756
Checksum:i6D1A15E7B5D1083C
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
M9PHZ6M9PHZ6_DROME
Cyclic-AMP response element binding...
CrebB CRE-BP, CREB, Creb, Creb B 17A, CREB-B
327Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M9PHW9M9PHW9_DROME
Cyclic-AMP response element binding...
CrebB CRE-BP, CREB, Creb, Creb B 17A, CREB-B
281Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1Z1CK36A0A1Z1CK36_DROME
Cyclic-AMP response element binding...
CrebB CRE-BP, CREB, Creb, Creb B 17A, CREB-B
331Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C6SUU1C6SUU1_DROME
Cyclic-AMP response element binding...
CrebB CRE-BP, CREB, Creb, Creb B 17A, CREB-B
296Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence ABI34195 differs from that shown. Reason: Erroneous initiation.Curated
The sequence ABI34226 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti46G → GG in AAB35092 (PubMed:7651429).Curated1
Sequence conflicti260A → V in AAB35092 (PubMed:7651429).Curated1
Sequence conflicti290T → A in ABI34195 (Ref. 6) Curated1
Sequence conflicti290T → A in ABI34226 (Ref. 6) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_051590101 – 128Missing in isoform D, isoform F, isoform G and isoform J. 3 PublicationsAdd BLAST28
Alternative sequenceiVSP_051591185 – 188Missing in isoform G and isoform J. 2 Publications4
Alternative sequenceiVSP_051592245 – 291GASLP…SYNTN → D in isoform F and isoform J. 2 PublicationsAdd BLAST47

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
S65627, S65623, S65626 Genomic DNA Translation: AAB28337.1
S79274 mRNA Translation: AAB35092.1
AE014298 Genomic DNA Translation: AAF48827.1
AE014298 Genomic DNA Translation: AAN09464.2
AE014298 Genomic DNA Translation: AAS65402.1
AE014298 Genomic DNA Translation: AAS65403.2
AE014298 Genomic DNA Translation: ABW09445.2
AE014298 Genomic DNA Translation: ABW09446.1
AE014298 Genomic DNA Translation: ABW09447.1
BT028813 mRNA Translation: ABI34194.2
BT028814 mRNA Translation: ABI34195.3 Different initiation.
BT028845 mRNA Translation: ABI34226.3 Different initiation.

NCBI Reference Sequences

More...
RefSeqi
NP_001097016.2, NM_001103546.3 [Q9VWW0-5]
NP_001097017.1, NM_001103547.4 [Q9VWW0-2]
NP_001097018.1, NM_001103548.4 [Q9VWW0-5]
NP_001259677.1, NM_001272748.2 [Q9VWW0-2]
NP_001259678.1, NM_001272749.2 [Q9VWW0-5]
NP_996504.1, NM_206781.4 [Q9VWW0-4]
NP_996506.2, NM_206783.4 [Q9VWW0-2]

Genome annotation databases

Ensembl metazoan genome annotation project

More...
EnsemblMetazoai
FBtr0074555; FBpp0074327; FBgn0265784 [Q9VWW0-2]
FBtr0074557; FBpp0074329; FBgn0265784 [Q9VWW0-4]
FBtr0112878; FBpp0111791; FBgn0265784 [Q9VWW0-2]
FBtr0112879; FBpp0111792; FBgn0265784 [Q9VWW0-5]
FBtr0310340; FBpp0302023; FBgn0265784 [Q9VWW0-2]
FBtr0310341; FBpp0302024; FBgn0265784 [Q9VWW0-5]
FBtr0346093; FBpp0311927; FBgn0265784 [Q9VWW0-5]
FBtr0446106; FBpp0402805; FBgn0265784 [Q9VWW0-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
32817

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
dme:Dmel_CG6103

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
S65627, S65623, S65626 Genomic DNA Translation: AAB28337.1
S79274 mRNA Translation: AAB35092.1
AE014298 Genomic DNA Translation: AAF48827.1
AE014298 Genomic DNA Translation: AAN09464.2
AE014298 Genomic DNA Translation: AAS65402.1
AE014298 Genomic DNA Translation: AAS65403.2
AE014298 Genomic DNA Translation: ABW09445.2
AE014298 Genomic DNA Translation: ABW09446.1
AE014298 Genomic DNA Translation: ABW09447.1
BT028813 mRNA Translation: ABI34194.2
BT028814 mRNA Translation: ABI34195.3 Different initiation.
BT028845 mRNA Translation: ABI34226.3 Different initiation.
RefSeqiNP_001097016.2, NM_001103546.3 [Q9VWW0-5]
NP_001097017.1, NM_001103547.4 [Q9VWW0-2]
NP_001097018.1, NM_001103548.4 [Q9VWW0-5]
NP_001259677.1, NM_001272748.2 [Q9VWW0-2]
NP_001259678.1, NM_001272749.2 [Q9VWW0-5]
NP_996504.1, NM_206781.4 [Q9VWW0-4]
NP_996506.2, NM_206783.4 [Q9VWW0-2]

3D structure databases

SMRiQ9VWW0
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi59134, 31 interactors
IntActiQ9VWW0, 15 interactors
STRINGi7227.FBpp0074326

PTM databases

iPTMnetiQ9VWW0

Proteomic databases

PaxDbiQ9VWW0

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
32817

Genome annotation databases

EnsemblMetazoaiFBtr0074555; FBpp0074327; FBgn0265784 [Q9VWW0-2]
FBtr0074557; FBpp0074329; FBgn0265784 [Q9VWW0-4]
FBtr0112878; FBpp0111791; FBgn0265784 [Q9VWW0-2]
FBtr0112879; FBpp0111792; FBgn0265784 [Q9VWW0-5]
FBtr0310340; FBpp0302023; FBgn0265784 [Q9VWW0-2]
FBtr0310341; FBpp0302024; FBgn0265784 [Q9VWW0-5]
FBtr0346093; FBpp0311927; FBgn0265784 [Q9VWW0-5]
FBtr0446106; FBpp0402805; FBgn0265784 [Q9VWW0-3]
GeneIDi32817
KEGGidme:Dmel_CG6103

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
32817
FlyBaseiFBgn0265784, CrebB

Phylogenomic databases

eggNOGiKOG3584, Eukaryota
GeneTreeiENSGT00940000173530
InParanoidiQ9VWW0
OMAiNMDNSIV
PhylomeDBiQ9VWW0

Enzyme and pathway databases

ReactomeiR-DME-198693, AKT phosphorylates targets in the nucleus
R-DME-199920, CREB phosphorylation
R-DME-375165, NCAM signaling for neurite out-growth
R-DME-442742, CREB1 phosphorylation through NMDA receptor-mediated activation of RAS signaling
R-DME-881907, Gastrin-CREB signalling pathway via PKC and MAPK
R-DME-9634638, Estrogen-dependent nuclear events downstream of ESR-membrane signaling
SignaLinkiQ9VWW0

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
32817, 0 hits in 3 CRISPR screens

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
32817

Protein Ontology

More...
PROi
PR:Q9VWW0

Gene expression databases

ExpressionAtlasiQ9VWW0, baseline and differential
GenevisibleiQ9VWW0, DM

Family and domain databases

InterProiView protein in InterPro
IPR004827, bZIP
IPR003102, Coactivator_CBP_pKID
IPR001630, Leuzip_CREB
PANTHERiPTHR45879, PTHR45879, 2 hits
PfamiView protein in Pfam
PF00170, bZIP_1, 1 hit
PF02173, pKID, 1 hit
SMARTiView protein in SMART
SM00338, BRLZ, 1 hit
PROSITEiView protein in PROSITE
PS50217, BZIP, 1 hit
PS00036, BZIP_BASIC, 1 hit
PS50953, KID, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCREBB_DROME
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9VWW0
Secondary accession number(s): A8JUN2
, A8JUN4, Q0IGS5, Q0IGV7, Q26329, Q26446, Q7KUW0, Q7KUW1, Q8IQY4
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 31, 2004
Last sequence update: May 1, 2000
Last modified: June 2, 2021
This is version 157 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Drosophila
    Drosophila: entries, gene names and cross-references to FlyBase
  2. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again