Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 144 (16 Oct 2019)
Sequence version 2 (01 Oct 2002)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Protein obstructor-E

Gene

obst-E

Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Chitin-binding protein that is important for the longitudinal contraction and lateral expansion of the larval cuticle during its conversion into the oval-shaped puparium case. Essential for survival to the second instar larval stage. Confers the orientated contractility and expandability of the larval cuticle by regulating the arrangement of chitin and the formation of supracellular ridges on the cuticle of third instar larvae. Essential for determining pupal body shape; required for the orientated shape change of the cuticle during metamorphosis which involves changes in the morphology of the supracellular ridges.1 Publication
Isoform A: Mainly involved in regulating pupal shape.1 Publication
Isoform B: Mainly involved in larvae survival, possibly by maintaining the normal morphology of the larval hindgut during development.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

  • chitin-based cuticle development Source: FlyBase
  • chitin metabolic process Source: InterPro

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

LigandChitin-binding

Protein family/group databases

Carbohydrate-Active enZymes

More...
CAZyi
CBM14 Carbohydrate-Binding Module Family 14

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Protein obstructor-E1 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:obst-E1 PublicationImported
ORF Names:CG11142Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiDrosophila melanogaster (Fruit fly)Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri7227 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraHolometabolaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000803 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2L

Organism-specific databases

Drosophila genome database

More...
FlyBasei
FBgn0031737 obst-E

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cuticle, Extracellular matrix, Secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

Larval lethal at the first instar stage. Hindgut development during embryogenesis appears normal but at the first instar larval stage the hindgut protrudes out of the anus and probably causes the lethality.1 Publication

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 21Sequence analysisAdd BLAST21
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_500934912522 – 249Protein obstructor-ESequence analysisAdd BLAST228

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi54 ↔ 70PROSITE-ProRule annotation
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi88N-linked (GlcNAc...) asparaginePROSITE-ProRule annotation1
Disulfide bondi124 ↔ 137PROSITE-ProRule annotation
Disulfide bondi203 ↔ 216PROSITE-ProRule annotation

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9VMM6

PRoteomics IDEntifications database

More...
PRIDEi
Q9VMM6

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Isoform A: Uniformly expressed throughout the cuticle of third instar larva.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
FBgn0031737 Expressed in 21 organ(s), highest expression level in larva

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

Protein interaction database and analysis system

More...
IntActi
Q9VMM6, 3 interactors

STRING: functional protein association networks

More...
STRINGi
7227.FBpp0078795

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9VMM6

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini22 – 80Chitin-binding type-2 1PROSITE-ProRule annotationAdd BLAST59
Domaini90 – 148Chitin-binding type-2 2PROSITE-ProRule annotationAdd BLAST59
Domaini170 – 227Chitin-binding type-2 3PROSITE-ProRule annotationAdd BLAST58

Keywords - Domaini

Repeat, Signal

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IW3Q Eukaryota
ENOG4111HJZ LUCA

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9VMM6

Identification of Orthologs from Complete Genome Data

More...
OMAi
NCPAADS

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9VMM6

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR002557 Chitin-bd_dom
IPR036508 Chitin-bd_dom_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF01607 CBM_14, 3 hits

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00494 ChtBD2, 3 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF57625 SSF57625, 3 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50940 CHIT_BIND_II, 3 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform B1 PublicationImported (identifier: Q9VMM6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAKILISALL CVAMFGSMAL GSPECPTPNG RFASGDQCDS YTECQDGTPV
60 70 80 90 100
EKLCPDGLLF HQRTKATGEC TYAPYSTCKE RARLQPANGT EECPRQFGFY
110 120 130 140 150
PNGDATKCGV YRNCAHGVAS LTKCPEGLAF NEETYQCDWP DLVESCNAEA
160 170 180 190 200
YLGFNCPAAD SADDSAAAAV DVSPEGELRY YRHPQTCKKY FVCVNGHPRL
210 220 230 240
YNCGKYLAFN SQTKLCDFYN KVPECYALLK EKQRLKAEKQ QPQVAQPED
Length:249
Mass (Da):27,480
Last modified:October 1, 2002 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iA8F9970D480B942C
GO
Isoform A1 PublicationImported (identifier: Q9VMM6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     20-50: LGSPECPTPNGRFASGDQCDSYTECQDGTPV → AAAAGACKEANGTAPVSGSCDAYIECKNGVAE
     60-123: FHQRTKATGE...CAHGVASLTK → YNEKSTGYPC...CAAGRGFVFD
     130-136: FNEETYQ → WNPATYK
     142-249: LVESCNAEAY...QQPQVAQPED → QVEDCDAEAF...KAARLHARKN

Show »
Length:242
Mass (Da):26,268
Checksum:iA4B681630AC56170
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti179R → S in AAN71355 (PubMed:12537569).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_05887720 – 50LGSPE…DGTPV → AAAAGACKEANGTAPVSGSC DAYIECKNGVAE in isoform A. Add BLAST31
Alternative sequenceiVSP_05887860 – 123FHQRT…ASLTK → YNEKSTGYPCGYPIDVECTQ GQARLQAAQPTDECPHQFGY YRMGDASHCGQFMNCAAGRG FVFD in isoform A. Add BLAST64
Alternative sequenceiVSP_058879130 – 136FNEETYQ → WNPATYK in isoform A. 7
Alternative sequenceiVSP_058880142 – 249LVESC…AQPED → QVEDCDAEAFLGFRCPAPAP RSELLGEQEADYTFHPSQDN CQVYFICIEGRPRRIGCGED QAFNQELNQCDDIENVPNCS SAIREKGAQIKAARLHARKN in isoform A. Add BLAST108

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AE014134 Genomic DNA Translation: AAF52287.2
AE014134 Genomic DNA Translation: AAN10555.1
AY069031 mRNA Translation: AAL39176.1
BT099959 mRNA Translation: ACX47660.1
BT001600 mRNA Translation: AAN71355.1

NCBI Reference Sequences

More...
RefSeqi
NP_608957.1, NM_135113.3 [Q9VMM6-2]
NP_723116.1, NM_164659.3 [Q9VMM6-1]

Genome annotation databases

Ensembl metazoan genome annotation project

More...
EnsemblMetazoai
FBtr0079163; FBpp0078794; FBgn0031737 [Q9VMM6-2]
FBtr0079164; FBpp0078795; FBgn0031737 [Q9VMM6-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
33806

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
dme:Dmel_CG11142

UCSC genome browser

More...
UCSCi
CG11142-RA d. melanogaster
CG11142-RB d. melanogaster [Q9VMM6-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AE014134 Genomic DNA Translation: AAF52287.2
AE014134 Genomic DNA Translation: AAN10555.1
AY069031 mRNA Translation: AAL39176.1
BT099959 mRNA Translation: ACX47660.1
BT001600 mRNA Translation: AAN71355.1
RefSeqiNP_608957.1, NM_135113.3 [Q9VMM6-2]
NP_723116.1, NM_164659.3 [Q9VMM6-1]

3D structure databases

SMRiQ9VMM6
ModBaseiSearch...

Protein-protein interaction databases

IntActiQ9VMM6, 3 interactors
STRINGi7227.FBpp0078795

Protein family/group databases

CAZyiCBM14 Carbohydrate-Binding Module Family 14

Proteomic databases

PaxDbiQ9VMM6
PRIDEiQ9VMM6

Genome annotation databases

EnsemblMetazoaiFBtr0079163; FBpp0078794; FBgn0031737 [Q9VMM6-2]
FBtr0079164; FBpp0078795; FBgn0031737 [Q9VMM6-1]
GeneIDi33806
KEGGidme:Dmel_CG11142
UCSCiCG11142-RA d. melanogaster
CG11142-RB d. melanogaster [Q9VMM6-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
33806
FlyBaseiFBgn0031737 obst-E

Phylogenomic databases

eggNOGiENOG410IW3Q Eukaryota
ENOG4111HJZ LUCA
InParanoidiQ9VMM6
OMAiNCPAADS
PhylomeDBiQ9VMM6

Miscellaneous databases

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
33806

Protein Ontology

More...
PROi
PR:Q9VMM6

Gene expression databases

BgeeiFBgn0031737 Expressed in 21 organ(s), highest expression level in larva

Family and domain databases

InterProiView protein in InterPro
IPR002557 Chitin-bd_dom
IPR036508 Chitin-bd_dom_sf
PfamiView protein in Pfam
PF01607 CBM_14, 3 hits
SMARTiView protein in SMART
SM00494 ChtBD2, 3 hits
SUPFAMiSSF57625 SSF57625, 3 hits
PROSITEiView protein in PROSITE
PS50940 CHIT_BIND_II, 3 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiOBSTE_DROME
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9VMM6
Secondary accession number(s): Q8IGU3, Q8T0V6
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 12, 2017
Last sequence update: October 1, 2002
Last modified: October 16, 2019
This is version 144 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Drosophila
    Drosophila: entries, gene names and cross-references to FlyBase
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again