Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q9VIH7 (SKY_DROME)

Entry version 140 (16 Oct 2019)
Sequence version 2 (01 Oct 2002)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

GTPase-activating protein skywalker

Gene

sky

Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

GTPase-activating protein (GAP) for Rab35 which regulates synaptic vesicle (SV) protein recycling and turnover at the neuromuscular junction boutons and possibly ventral nerve cord via endosomal trafficking (PubMed:21458671, PubMed:25422373, PubMed:27669036). Inhibits Rab35-mediated endosomal sorting which traffics old or dysfunctional SV proteins through a degradative endolysosomal route that involves the ESCRT pathway and the HOPS complex members dor, vps39 and rab7 (PubMed:21458671, PubMed:25422373). This function is essential for preventing excessive degradation and turnover of vesicles from the readily releasable pool which leads to increased neurotransmission and eventually neurodegeneration (PubMed:21458671, PubMed:25422373, PubMed:27669036). Preferentially binds phosphoinositides phosphorylated at the D5 position of the inositol ring, such as phosphatidylinositol 4,5-bisphosphate (PIP2) and phosphatidylinositol 3,4,5-trisphosphate (PIP3) (PubMed:27669036). Binding to phosphoinositides and thus membrane-association, is required for its function in regulating the turnover of synaptic-vesicle proteins (PubMed:27669036). It is therefore likely that it is recruited to vesicle membranes with high phosphoinositide content and thereby selectively prevents endolysosomal degradation of these vesicles (PubMed:27669036).3 Publications

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei75PhosphatidylinositolCombined sources1 Publication1
Binding sitei79PhosphatidylinositolCombined sources1 Publication1
Binding sitei277PhosphatidylinositolCombined sources1 Publication1
Binding sitei281PhosphatidylinositolCombined sources1 Publication1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • GTPase activator activity Source: FlyBase
  • GTPase activity Source: UniProtKB
  • lipid binding Source: UniProtKB-KW
Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

LigandLipid-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-DME-8854214 TBC/RABGAPs

Protein family/group databases

Transport Classification Database

More...TCDBi		8.A.126.1.2 the nuclear receptor coactivator 7 (ncoa7) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
GTPase-activating protein skywalker1 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:sky1 PublicationImported
ORF Names:CG9339Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiDrosophila melanogaster (Fruit fly)Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri7227 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Ecdysozoa › Arthropoda › Hexapoda › Insecta › Pterygota › Neoptera › Holometabola › Diptera › Brachycera › Muscomorpha › Ephydroidea › Drosophilidae › Drosophila › Sophophora ›
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000803 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2L

Organism-specific databases

Drosophila genome database

More...FlyBasei		FBgn0032901 sky

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell junction, Cytoplasmic vesicle, Endosome, Membrane, Synapse

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi79R → C: Loss of binding to liposomes containing phosphoinositides. In contrast to wild-type protein whose expression largely rescues mutant phenotypes, expression in mutant neurons only partially rescues the increase in synapse mobility and the abherent accumulation of large cisternal or endosomal-like structures in pre-synaptic terminals observed in mutants. In addition, the number of mutants displaying defective motor coordination, defective flight, hyperactivity, increased temperature sensitivity and seziures is increased compared to mutants expressing wild-type protein. 1 Publication1
Mutagenesisi281R → C: Reduced binding to liposomes under low phosphatidylinositol 4,5-bisphosphate (PIP2) concentrations. Reduced binding to inositol 1,4,5-trisphosphate (IP3). In contrast to wild-type, expression only partially rescues the accumulation of sub-boutonic foci. 1 Publication1
Mutagenesisi335R → P: Little effect on binding to liposomes, phosphatidylinositol 4,5-bisphosphate and inositol 1,4,5-trisphosphate. 1 Publication1
Mutagenesisi543G → R in sky-1; embryonic lethal. 1 Publication1

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00004456231 – 587GTPase-activating protein skywalkerAdd BLAST587

Keywords - PTMi

Phosphoprotein

Proteomic databases

PRoteomics IDEntifications database

More...PRIDEi		Q9VIH7

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Detected in the larval ventral nerve cord and neuromuscular junction boutons (at protein level).1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		FBgn0032901

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

Protein interaction database and analysis system

More...IntActi		Q9VIH7, 1 interactor

STRING: functional protein association networks

More...STRINGi		7227.FBpp0303287

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1587
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q9VIH7

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini84 – 275Rab-GAP TBCPROSITE-ProRule annotationAdd BLAST192
Domaini408 – 585TLDcPROSITE-ProRule annotationAdd BLAST178

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni335 – 339Phosphatidylinositol bindingCombined sources1 Publication5

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The Rab-GAP TBC domain is essential for phosphoinositide binding.1 Publication

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG2801 Eukaryota
ENOG410ZI2X LUCA

Ensembl GeneTree

More...GeneTreei		ENSGT00410000025739

KEGG Orthology (KO)

More...KOi		K21841

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR000195 Rab-GTPase-TBC_dom
IPR035969 Rab-GTPase_TBC_sf
IPR006571 TLDc_dom

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00566 RabGAP-TBC, 1 hit
PF07534 TLD, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00164 TBC, 1 hit
SM00584 TLDc, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF47923 SSF47923, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50086 TBC_RABGAP, 1 hit
PS51886 TLDC, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform AImported (identifier: Q9VIH7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPYHRGGDAS SQADKLSGIV EESDLYEGFA PHVETSEIKT LDFYNLPKQT 
        60         70         80         90        100
GKEPALRSYT EIQQLLQQGK KRDVKNILRE NSWPINSPIR AQLWPMLCGQ 
       110        120        130        140        150
HQTKQQMLDG FYWEMVHQVF GTTELSEKPI MLPAFVDATH CLPYHLTSTG 
       160        170        180        190        200
RAVADRIVNV LGYDCPDITY SPVLYPITSI LLHFMSEEEA YICLAGLVGS 
       210        220        230        240        250
KEKVFINQTK LQHEVTWKTV MQIAKKHTKS ATSYFQRICP GLKLERIFMD 
       260        270        280        290        300
WCWWILAGLP FQHLVRIMDC YFHEGIKVLY RVALVILNLF HKECQSNNEW 
       310        320        330        340        350
SPDNIKNDIG NALIKFCKKI PVSPAKLLHA AFSIRGLSTQ YISRIFIKTE 
       360        370        380        390        400
MLLKSRSVLT SGSKQLIKSR SSDNLPTSQS QVNIQMMSHT LTIREHFGLP 
       410        420        430        440        450
GTKNFIKTWT DRQFLFTLWS WLPVRITMYQ PVLLYTTEEH GCSLTTFYVR 
       460        470        480        490        500
VEQHEPTLLM IKTCNNEVFG AYCSSRWFER NVKDDKGQRQ AYFGTGETFL 
       510        520        530        540        550
FSLYPERAKY PWVGIEGDKD LGHSSELFMA ADSKMITIGG GEGQAIWMDE 
       560        570        580 
NIRFGKTDSC KTFNNPPLCP SGDFEIRVLE VYGFVGI
Length:587
Mass (Da):67,328
Last modified:October 1, 2002 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i54E1543FCA208164
GO
Isoform JImported (identifier: Q9VIH7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     396-414: HFGLPGTKNFIKTWTDRQF → KLHSESCRNLGEKSPGHRAIAMGVYPIHNLKSQACKNED

Show »
Length:607
Mass (Da):69,354
Checksum:i3540244B0418FF04
GO
Isoform FImported (identifier: Q9VIH7-3) [UniParc]FASTAAdd to basket
Also known as: IImported

The sequence of this isoform differs from the canonical sequence as follows:
     1-50: MPYHRGGDAS...LDFYNLPKQT → MVGKVLGIKD...TKCQCFQFSP
     396-414: Missing.

Show »
Length:573
Mass (Da):65,703
Checksum:iC2360FBED72C6EF1
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q9VIH6Q9VIH6_DROME
Skywalker, isoform C
sky anon-WO0118547.455, CG14399, CG9340, Dmel\CG9339, Sky
592Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q0E8N9Q0E8N9_DROME
Skywalker, isoform D
sky anon-WO0118547.455, CG14399, CG9340, Dmel\CG9339, Sky
568Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M9PDI9M9PDI9_DROME
Skywalker, isoform L
sky anon-WO0118547.455, CG14399, CG9340, Dmel\CG9339, Sky
606Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M9PDV9M9PDV9_DROME
Skywalker, isoform K
sky anon-WO0118547.455, CG14399, CG9340, Dmel\CG9339, Sky
597Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAM49859 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0599171 – 50MPYHR…LPKQT → MVGKVLGIKDLEQFSSRRSS VYVDPECDKFFELPLFIAAS SNDITTKCQCFQFSP in isoform F. Add BLAST50
Alternative sequenceiVSP_059918396 – 414Missing in isoform F. Add BLAST19
Alternative sequenceiVSP_059919396 – 414HFGLP…TDRQF → KLHSESCRNLGEKSPGHRAI AMGVYPIHNLKSQACKNED in isoform J. Add BLAST19

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AE014134 Genomic DNA Translation: AAF53942.2
AE014134 Genomic DNA Translation: AAF53945.2
AE014134 Genomic DNA Translation: AAS64731.1
AE014134 Genomic DNA Translation: AAN11097.2
AE014134 Genomic DNA Translation: ACZ94312.1
AE014134 Genomic DNA Translation: AGB93184.1
AY069398 mRNA Translation: AAL39543.1
AY118379 mRNA Translation: AAM48408.1
AY118490 mRNA Translation: AAM49859.1 Different initiation.
BT120183 mRNA Translation: ADB91431.1

NCBI Reference Sequences

More...RefSeqi		NP_001163026.1, NM_001169555.1 [Q9VIH7-3]
NP_001260649.1, NM_001273720.1 [Q9VIH7-2]
NP_610073.1, NM_136229.5 [Q9VIH7-1]
NP_724302.1, NM_165350.4 [Q9VIH7-1]
NP_724303.2, NM_165351.4 [Q9VIH7-3]
NP_995738.1, NM_206016.3 [Q9VIH7-1]

Genome annotation databases

Ensembl metazoan genome annotation project

More...EnsemblMetazoai		FBtr0081441; FBpp0080970; FBgn0032901 [Q9VIH7-1]
FBtr0081442; FBpp0080971; FBgn0032901 [Q9VIH7-1]
FBtr0081445; FBpp0080974; FBgn0032901 [Q9VIH7-3]
FBtr0081447; FBpp0080976; FBgn0032901 [Q9VIH7-1]
FBtr0301961; FBpp0291173; FBgn0032901 [Q9VIH7-3]
FBtr0330255; FBpp0303287; FBgn0032901 [Q9VIH7-2]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		35359

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		dme:Dmel_CG9339

UCSC genome browser

More...UCSCi		CG9339-RA d. melanogaster [Q9VIH7-1]
CG9339-RE d. melanogaster

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AE014134 Genomic DNA Translation: AAF53942.2
AE014134 Genomic DNA Translation: AAF53945.2
AE014134 Genomic DNA Translation: AAS64731.1
AE014134 Genomic DNA Translation: AAN11097.2
AE014134 Genomic DNA Translation: ACZ94312.1
AE014134 Genomic DNA Translation: AGB93184.1
AY069398 mRNA Translation: AAL39543.1
AY118379 mRNA Translation: AAM48408.1
AY118490 mRNA Translation: AAM49859.1 Different initiation.
BT120183 mRNA Translation: ADB91431.1
RefSeqiNP_001163026.1, NM_001169555.1 [Q9VIH7-3]
NP_001260649.1, NM_001273720.1 [Q9VIH7-2]
NP_610073.1, NM_136229.5 [Q9VIH7-1]
NP_724302.1, NM_165350.4 [Q9VIH7-1]
NP_724303.2, NM_165351.4 [Q9VIH7-3]
NP_995738.1, NM_206016.3 [Q9VIH7-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
5HJNX-ray2.50A1-353[»]
5HJQX-ray2.30A1-353[»]
6R82X-ray2.05A/B401-587[»]
SMRiQ9VIH7
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

IntActiQ9VIH7, 1 interactor
STRINGi7227.FBpp0303287

Protein family/group databases

TCDBi8.A.126.1.2 the nuclear receptor coactivator 7 (ncoa7) family

Proteomic databases

PRIDEiQ9VIH7

Genome annotation databases

EnsemblMetazoaiFBtr0081441; FBpp0080970; FBgn0032901 [Q9VIH7-1]
FBtr0081442; FBpp0080971; FBgn0032901 [Q9VIH7-1]
FBtr0081445; FBpp0080974; FBgn0032901 [Q9VIH7-3]
FBtr0081447; FBpp0080976; FBgn0032901 [Q9VIH7-1]
FBtr0301961; FBpp0291173; FBgn0032901 [Q9VIH7-3]
FBtr0330255; FBpp0303287; FBgn0032901 [Q9VIH7-2]
GeneIDi35359
KEGGidme:Dmel_CG9339
UCSCiCG9339-RA d. melanogaster [Q9VIH7-1]
CG9339-RE d. melanogaster

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		35359
FlyBaseiFBgn0032901 sky

Phylogenomic databases

eggNOGiKOG2801 Eukaryota
ENOG410ZI2X LUCA
GeneTreeiENSGT00410000025739
KOiK21841

Enzyme and pathway databases

ReactomeiR-DME-8854214 TBC/RABGAPs

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		sky fly

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		35359

Gene expression databases

BgeeiFBgn0032901

Family and domain databases

InterProiView protein in InterPro
IPR000195 Rab-GTPase-TBC_dom
IPR035969 Rab-GTPase_TBC_sf
IPR006571 TLDc_dom
PfamiView protein in Pfam
PF00566 RabGAP-TBC, 1 hit
PF07534 TLD, 1 hit
SMARTiView protein in SMART
SM00164 TBC, 1 hit
SM00584 TLDc, 1 hit
SUPFAMiSSF47923 SSF47923, 1 hit
PROSITEiView protein in PROSITE
PS50086 TBC_RABGAP, 1 hit
PS51886 TLDC, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSKY_DROME
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9VIH7
Secondary accession number(s): D3DML7
, Q8INU4, Q8MSY5, Q8MT51, Q8T0D2
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 7, 2018
Last sequence update: October 1, 2002
Last modified: October 16, 2019
This is version 140 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Drosophila
    Drosophila: entries, gene names and cross-references to FlyBase
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again