Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 163 (07 Oct 2020)
Sequence version 3 (03 Mar 2009)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Dystrophin, isoforms A/C/F/G/H

Gene

Dys

Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Required for the maintenance of appropriate synaptic retrograde communication and the stabilization of muscle cell architecture or physiology. Both det and Dg are required for maintenance of early dpp signaling in the presumptive crossvein. Isoform A is not required to maintain muscle integrity, but plays a role in neuromuscular homeostasis by regulating neurotransmitter release. May play a role in anchoring the cytoskeleton to the plasma membrane.3 Publications

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri3106 – 3153ZZ-typePROSITE-ProRule annotationCuratedAdd BLAST48

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActin-binding
LigandCalcium, Metal-binding, Zinc

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-DME-114608, Platelet degranulation
R-DME-446388, Regulation of cytoskeletal remodeling and cell spreading by IPP complex components

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
Q9VDW6

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Dystrophin, isoforms A/C/F/G/H
Short name:
DmDYS
Alternative name(s):
Protein detached
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Dys
Synonyms:det
ORF Names:CG34157
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiDrosophila melanogaster (Fruit fly)Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri7227 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraHolometabolaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000803 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 3R

Organism-specific databases

Drosophila genome database

More...
FlyBasei
FBgn0260003, Dys

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Cytoskeleton, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

Wings exhibit a 'crossveinless' phenotype. Adult flies are viable and the crossvein defect is the sole overt morphological defect observed. Flies that have reduced expression of all isoforms (due to transgenic RNA interference targeting the common C-terminal region) exhibit severe muscle degeneration in larvae and adult flies. Muscles were either ruptured, absent or the fibers were detached from their attachment sites at tendon cells. These are necrotic, not apoptotic processes.2 Publications

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000760801 – 3598Dystrophin, isoforms A/C/F/G/HAdd BLAST3598

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei1832Phosphoserine1 Publication1
Modified residuei1838Phosphoserine1 Publication1
Modified residuei3207Phosphoserine1 Publication1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9VDW6

PRoteomics IDEntifications database

More...
PRIDEi
Q9VDW6

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9VDW6

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Isoform A, isoform F and isoform G are expressed in the midgut endoderm of stage 12 embryos. In stage 16 embryos, expression is also seen in the pericardial cells, cells at the ectoderm segmental border and cells along the midline of the CNS. During embryogenesis, isoform A is also expressed in the visceral mesoderm, muscle attachment sites, mesectodermal cells at the midline, the gut, and throughout muscle fibers. In larvae, isoform A is found in all muscle fibers, but not detectable in the brain or neuropil.2 Publications

<p>This subsection of the 'Expression' section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified 'at the protein level'.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Isoform A is expressed in embryos and larvae and levels increase further in adults. Isoform F has weak expression in embryos, increases in larvae and falls again in adults. Isoform G is weakly expressed in adult flies, and not detectable earlier in development.2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
FBgn0260003, Expressed in spermathecum and 59 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9VDW6, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9VDW6, DM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Component of the dystrophin associated protein complex (DAPC).

Interacts with Dg, via the Dg WW domain binding sites.

2 Publications

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
67322, 74 interactors

Protein interaction database and analysis system

More...
IntActi
Q9VDW6, 39 interactors

STRING: functional protein association networks

More...
STRINGi
7227.FBpp0110219

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9VDW6

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini12 – 116Calponin-homology (CH) 1PROSITE-ProRule annotationCuratedAdd BLAST105
Domaini127 – 230Calponin-homology (CH) 2PROSITE-ProRule annotationCuratedAdd BLAST104
<p>This subsection of the 'Family and Domains' section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati307 – 420Spectrin 1Add BLAST114
Repeati423 – 525Spectrin 2Add BLAST103
Repeati851 – 963Spectrin 3Add BLAST113
Repeati1056 – 1170Spectrin 4Add BLAST115
Repeati1173 – 1275Spectrin 5Add BLAST103
Repeati1381 – 1483Spectrin 6Add BLAST103
Repeati2237 – 2363Spectrin 7Add BLAST127
Repeati2366 – 2472Spectrin 8Add BLAST107
Repeati2475 – 2576Spectrin 9Add BLAST102
Repeati2579 – 2712Spectrin 10Add BLAST134
Repeati2715 – 2819Spectrin 11Add BLAST105
Domaini2849 – 2882WWPROSITE-ProRule annotationCuratedAdd BLAST34

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 230Actin-bindingAdd BLAST230

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri3106 – 3153ZZ-typePROSITE-ProRule annotationCuratedAdd BLAST48

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG4286, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000166230

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9VDW6

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9VDW6

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00014, CH, 1 hit
cd00201, WW, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.418.10, 2 hits
3.30.60.90, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR001589, Actinin_actin-bd_CS
IPR001715, CH-domain
IPR036872, CH_dom_sf
IPR035436, Dystrophin/utrophin
IPR011992, EF-hand-dom_pair
IPR015153, EF-hand_dom_typ1
IPR015154, EF-hand_dom_typ2
IPR018159, Spectrin/alpha-actinin
IPR002017, Spectrin_repeat
IPR001202, WW_dom
IPR036020, WW_dom_sf
IPR000433, Znf_ZZ
IPR043145, Znf_ZZ_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00307, CH, 2 hits
PF09068, EF-hand_2, 1 hit
PF09069, EF-hand_3, 1 hit
PF00435, Spectrin, 2 hits
PF00569, ZZ, 1 hit

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF002341, Dystrophin/utrophin, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00033, CH, 2 hits
SM00150, SPEC, 11 hits
SM00456, WW, 1 hit
SM00291, ZnF_ZZ, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF47473, SSF47473, 2 hits
SSF47576, SSF47576, 1 hit
SSF51045, SSF51045, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00019, ACTININ_1, 1 hit
PS00020, ACTININ_2, 1 hit
PS50021, CH, 2 hits
PS50020, WW_DOMAIN_2, 1 hit
PS01357, ZF_ZZ_1, 1 hit
PS50135, ZF_ZZ_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (8+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 8 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 8 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform H (identifier: Q9VDW6-5) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEPGILIDER QHIQKKTFTK WINSHLIDTQ CTPVKDLFLD LRDGHRLLAL
60 70 80 90 100
LSTLTQTNLK PEKGRMRVHH INNLNKVITE IQQHGVKLVN ISSDDIVGGN
110 120 130 140 150
AKLTLGLIWL IALEFNGQHL VKSHSSNGVE KSLLAWARQY TEPHGLQLND
160 170 180 190 200
FSSSWSDGRA FLMILDAHVE ELNLQAALQQ HALKRLHLAF DLAHRHFKIE
210 220 230 240 250
KLLDAEDVHT HKPDNKSIQM YVMCLYHAME SMRTRQQEQE QDEGQDQDPG
260 270 280 290 300
RVPCTSITDL DEVPLDNDQT SLGLYTSDSA GSMEQRSSGE LKTHSMRPLS
310 320 330 340 350
TATNASVEIS GYQSALEAVL TLLLEDEQLL SQNLPDPQDF QTAKLQFHEN
360 370 380 390 400
ESFMLKLTEH QEYVGEALEE GSNLINESQK AGAGLSQEDQ NEVRQQMVLL
410 420 430 440 450
NERWETLRLR ALDVQAKILM RLAEFQKQKL EQLRQFLTSV EDRISHMSDI
460 470 480 490 500
GPTLEEAEKQ LLEAQKLKAD LSEQQELVDS LSSMVVIVND TSGNFNDLED
510 520 530 540 550
RLSALGERWS HVVKWSDLRK EKLQQYKCIS RWLDAREQDL KLMESRDVTD
560 570 580 590 600
VGGITQRINE LNYCAKDLLE LQRYLIDLRQ MVAATLQDGD DKGERVLIQL
610 620 630 640 650
ESYEDRLDAL KQIVEVQTVR IETKGFNFGR DRASYDDSRV VRPEGWVDYQ
660 670 680 690 700
MIIRFGEDDS QEDDDEHDLA SKKRKLRNAD NFNALENHIM EHFGYVQEVE
710 720 730 740 750
QKLQQLQRQS LRQQCELLKE LQAENSRRCG TLPELKKLYE VCELEDPSRN
760 770 780 790 800
LLLEETHIKQ LEQRYANLSQ KLSSQQSESH TLLAKEKYYN SLTGFKLVLA
810 820 830 840 850
DSRDWYKQHA GSASGNELEQ RLSHMESLAS EISEAKTATE ELDDNLIEWK
860 870 880 890 900
QDFGLFYDSW HDMKQALQAL IQQRGGESLS RQLKQIQDFV TKVSNQKVRV
910 920 930 940 950
SNLEVMQEQQ HFLNQLLDEM ESLRLTYDNI PKHLIGEELQ TAWNRLPEQL
960 970 980 990 1000
NERVIKQTTA IENLNHFAAE YNAIIAMLRS AADSKLNGSD GASSQDLRKL
1010 1020 1030 1040 1050
EIDVISARNF SEILIKEAEP AQKESLQSQI RALNTLYDQV EQVHREKKEQ
1060 1070 1080 1090 1100
QTVLQSHIDL IQLRLKETDQ WLTDLESNTP KSGISDIVNS NELFQSKSRF
1110 1120 1130 1140 1150
QTLKETCERE TTQFRDLNER GGELLLQMDE LQDQDRESRY GSLAKQFTRI
1160 1170 1180 1190 1200
NARWTEVTEL VYAKTALLEH ISTQLGEFKK FMVSETGYLD KLENKIRNTP
1210 1220 1230 1240 1250
ENAADAEEIM EELDDLENVL RSHSEEWLDK IQEIGNELID NEFMADSIRR
1260 1270 1280 1290 1300
DIDETVQRWT QLQQQAKKRT ELLEQKVSEA EQSEKCIVQF EKWLTRVDDI
1310 1320 1330 1340 1350
LSDHLDNDVT IVDQPEEFQR LAHEFVANEK NFKEISELID EHTRNGKVGA
1360 1370 1380 1390 1400
ANRLQEQLNL MEVRFKYCQA KLSKCTAIQH SYESRLNRAY TDLRNVERST
1410 1420 1430 1440 1450
EVVDVASAGP NTVQTQYQKC LQIYRTLSEI KSEIESTIKT GRRVCEDRYT
1460 1470 1480 1490 1500
KSPKQLSQRI DALKHLYNTL GENVTQSKAT LERLLTLARQ LEECFDSADN
1510 1520 1530 1540 1550
LIRRFESPQE VHDRNSILLE FEDVLRRCED HYNEYNKSCD QSCMVETRQR
1560 1570 1580 1590 1600
IDGLKATYHK LTSADIIKRL TEMKTTLQNL DNISLETLRA MEHDLKEINV
1610 1620 1630 1640 1650
PSNPEIEKLQ QQVIAIVVDV LKTRFNEATT LAARNTSSPD NDDTEIVVVS
1660 1670 1680 1690 1700
DTVRQRRART PQSGESPSSA HTSSSESPTK GVENSPGAVG DQVMPDLLPP
1710 1720 1730 1740 1750
QTFRLAESST LFSQISLNPQ KVTNTPPPKP AKTKRKAPSS PAQVVEIRVK
1760 1770 1780 1790 1800
NIQNDKMSVQ NIDLEPQQGE IVDTVNILES VEPFVPEYVE TVQIVDLSED
1810 1820 1830 1840 1850
SDSSVRVDSQ GKEMRRSKSK HSLNETPLPK VSDNDEDSAE QEEDLLRPSA
1860 1870 1880 1890 1900
ENTSTPFLRV EKRRISFDEK RKRVANERDI LRDSEEEEPK TPDTPRAAQV
1910 1920 1930 1940 1950
SKPKRWRQLQ PEMDALEPES PGRDSFYSPD KESGFDAEPL VFSDDEDIPR
1960 1970 1980 1990 2000
FSLEMTSTID SDSDTSRIMT PSTKNPNPFL SKVLESLSSP VDDSNVTLKS
2010 2020 2030 2040 2050
PISEEQPQNL DDRVREFDKQ AKQMIYKLKL TKAKIEQCHE SEAEDLRLLI
2060 2070 2080 2090 2100
APDAATLISQ GDSLVLETHG RQGSISRLVM RTQIILREQF REVQQARSKT
2110 2120 2130 2140 2150
SGSGAPAPPL DSVNIEELVT KGLRRINVLI EKTVDLKSST DLEKRMEDIN
2160 2170 2180 2190 2200
ERHDDLQVIV SAIGKNAQMP KVTPLMMNEI EKTKNNLIAH ADSIELSLTE
2210 2220 2230 2240 2250
LRNGPRISNG KERPDASSAA TMSCRSEYNN EPSGTGALAG SFDKSVLQIS
2260 2270 2280 2290 2300
DWLTWEQNMI KIQSVLVDDG DAVRLAIEKQ EKVLRELKMK KPQLNELVHT
2310 2320 2330 2340 2350
AEVLKGDVKR QQLQEKELKQ FSLAPHCSAD LDYMRCCLKV TRLREHWDET
2360 2370 2380 2390 2400
SQCVLQRAAQ LKNMLSDSQR FEAKRLELEK WLARMEQRAE RMGTIATTAD
2410 2420 2430 2440 2450
ILEAQQKEQK SFHAELHQNK QHFDIFNELT QKLIAVYPND DTTRIKKMTE
2460 2470 2480 2490 2500
VINQRYANLN SGVINRGKQL HAAVHSLQSF DRAMDQFLAF LSETETLCEN
2510 2520 2530 2540 2550
AESDIERNPL MFKDLQSEIE THRVVYDRLD GTGRKLLGSL TSQEDAVMLQ
2560 2570 2580 2590 2600
RRLDEMNQRW NNLKSKSIAI RNRLESNSEH WNALLLSLRE LTEWVIRKDT
2610 2620 2630 2640 2650
ELSTLGLGPV RGDAVSLQKQ LDDHKAFRRQ LEDKRPIVES NLTSGRQYIA
2660 2670 2680 2690 2700
NEAAVSDTSD TEANHDSDSR YMSAEEQSRE LTRSIRREVG KLSEQWNNLI
2710 2720 2730 2740 2750
DRSDNWKHRL DEYMTKMRQF QKILEDLSSR VALAEQTKTS WLPPSSVGEA
2760 2770 2780 2790 2800
NEQMQQLQRL RDKMTTASAL LDDCNEQQSF FTANQVLVPT PCLSKLEDLN
2810 2820 2830 2840 2850
TRMKLLQIAM DERQKVLCQA GAQQTHENGD DGRTTSNSGT IGPLPNLGQS
2860 2870 2880 2890 2900
VKPPWERATT AANVPYYIDH ERETTHWDHP EMIELMKGLA DLNEIRFSAY
2910 2920 2930 2940 2950
RTAMKLRSVQ KRLALDRISM STACESFDRH GLRAQNDKLI DIPDMTTVLH
2960 2970 2980 2990 3000
SLYVTIDKID LTLMLDLAIN WILNVYDSQR TGQIRVLSFK VGLVLLCKGH
3010 3020 3030 3040 3050
LEEKYRYLFR LVADTDRRAD QRRLGLLLHD CIQVPRQLGE VAAFGGSNIE
3060 3070 3080 3090 3100
PSVRSCLEQA GISQEAIDGN QDISIELQHF LGWLQHEPQS LVWLPVLHRL
3110 3120 3130 3140 3150
AAAEAAKHQA KCNICKEYPI VGFRYRCLKC FNFDMCQKCF FFGRNAKNHK
3160 3170 3180 3190 3200
LTHPMHEYCT TTTSTEDVRD FTRALKNKFK SRKYFKKHPR VGYLPVQSVL
3210 3220 3230 3240 3250
EGDALESPAP SPQHTTHQLQ NDMHSRLEMY ASRLAQVEYG GTGSNSTPDS
3260 3270 3280 3290 3300
DDEHQLIAQY CQALPGTSNG SAPKSPVQVM AAMDAEQREE LEAIIRDLEE
3310 3320 3330 3340 3350
ENANLQAEYQ QLCSKEQSGM PEDSNGMQHS SSSMTGLSGQ GEQGQDMMAE
3360 3370 3380 3390 3400
AKLLRQHKGR LEARMQILED HNRQLEAQLQ RLRQLLDEPN GGGSSATSSG
3410 3420 3430 3440 3450
LPSAPGSALN SKPNTLQTRS VTASQLNTDS PAKMNQQNGH YEHNSKGIML
3460 3470 3480 3490 3500
PGMNSEIQQQ HAQLASLAAK HHQHQLSGAL NALHQQQQQQ LQQQPPQQQR
3510 3520 3530 3540 3550
SMMTGNGGMD ISGGMQTSGG YLGDDGRPPP PPHSSLMQQQ HQQHLNENSS
3560 3570 3580 3590
GLVTVITEQE LESINDDLED SSSSNTTNTT TTTTTTATTE KTCVELQK
Length:3,598
Mass (Da):410,414
Last modified:March 3, 2009 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i97848038A8DD0C99
GO
Isoform A1 Publication (identifier: Q9VDW6-1) [UniParc]FASTAAdd to basket
Also known as: DLP21 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     3447-3547: Missing.

Show »
Length:3,497
Mass (Da):399,402
Checksum:i33A4BE7D504506E4
GO
Isoform C1 Publication (identifier: Q9VDW6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1619-1965: Missing.
     2316-2338: Missing.

Show »
Length:3,228
Mass (Da):369,072
Checksum:iB780E135254610A7
GO
Isoform F (identifier: Q9VDW6-3) [UniParc]FASTAAdd to basket
Also known as: DLP11 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     1-7: MEPGILI → MHDPSDYDSVYSEEDFVDTVRGAATPPLMDYEEFRVKTM

Show »
Length:3,630
Mass (Da):414,187
Checksum:i23E3830C1A171CDA
GO
Isoform G (identifier: Q9VDW6-4) [UniParc]FASTAAdd to basket
Also known as: DLP31 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     1-7: MEPGILI → MAYNLALKPADLAR

Show »
Length:3,605
Mass (Da):411,189
Checksum:i1F6BBDE5F2AA67E9
GO
Isoform B1 Publication (identifier: Q9VDW3-1) [UniParc]FASTAAdd to basket
Also known as: Dp186
The sequence of this isoform can be found in the external entry Q9VDW3.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
Length:1,669
Mass (Da):185,311
GO
Isoform D (identifier: Q0KI50-1) [UniParc]FASTAAdd to basket
Also known as: Dp205
The sequence of this isoform can be found in the external entry Q0KI50.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
Length:1,854
Mass (Da):205,723
GO
Isoform E (identifier: Q7YU29-1) [UniParc]FASTAAdd to basket
Also known as: Dp117
The sequence of this isoform can be found in the external entry Q7YU29.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
Length:1,051
Mass (Da):116,741
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0B4KGH0A0A0B4KGH0_DROME
Dystrophin, isoform K
Dys CG17750, CG31175, CG7240, CG7243, CG7344
3,144Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0B4KHR4A0A0B4KHR4_DROME
Dystrophin, isoform I
Dys CG17750, CG31175, CG7240, CG7243, CG7344
3,228Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0B4KGB9A0A0B4KGB9_DROME
Dystrophin, isoform L
Dys CG17750, CG31175, CG7240, CG7243, CG7344
1,323Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0B4KHE2A0A0B4KHE2_DROME
Dystrophin, isoform J
Dys CG17750, CG31175, CG7240, CG7243, CG7344
1,152Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti2615V → A in AAK15256 (PubMed:11223239).Curated1
Sequence conflicti2682T → R in AAK15256 (PubMed:11223239).Curated1
Sequence conflicti2700I → L in AAK15256 (PubMed:11223239).Curated1
Sequence conflicti2873E → Q in AAK15256 (PubMed:11223239).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0507291 – 7MEPGILI → MHDPSDYDSVYSEEDFVDTV RGAATPPLMDYEEFRVKTM in isoform F. 1 Publication7
Alternative sequenceiVSP_0507301 – 7MEPGILI → MAYNLALKPADLAR in isoform G. 1 Publication7
Alternative sequenceiVSP_0507311619 – 1965Missing in isoform C. 1 PublicationAdd BLAST347
Alternative sequenceiVSP_0507322316 – 2338Missing in isoform C. 1 PublicationAdd BLAST23
Alternative sequenceiVSP_0365003447 – 3547Missing in isoform A. 1 PublicationAdd BLAST101

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF277386 mRNA Translation: AAG17395.1
AF297644 mRNA Translation: AAK15256.1
AF300456 mRNA Translation: AAK15258.1
AF302236 mRNA Translation: AAK18176.1
AE014297 Genomic DNA Translation: AAF55673.2
AE014297 Genomic DNA Translation: AAF55675.2
AE014297 Genomic DNA Translation: ABI31176.1
AE014297 Genomic DNA Translation: ABI31178.1
AE014297 Genomic DNA Translation: ABI31180.1

NCBI Reference Sequences

More...
RefSeqi
NP_001036722.1, NM_001043257.2 [Q9VDW6-5]
NP_001036723.1, NM_001043258.2 [Q9VDW6-1]
NP_001036724.1, NM_001043259.2
NP_001036726.1, NM_001043261.2
NP_001036728.1, NM_001043263.2

Genome annotation databases

Ensembl metazoan genome annotation project

More...
EnsemblMetazoai
FBtr0083764; FBpp0083178; FBgn0260003 [Q9VDW6-1]
FBtr0110919; FBpp0110219; FBgn0260003 [Q9VDW6-5]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
42327

UCSC genome browser

More...
UCSCi
CG34157-RH, d. melanogaster

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF277386 mRNA Translation: AAG17395.1
AF297644 mRNA Translation: AAK15256.1
AF300456 mRNA Translation: AAK15258.1
AF302236 mRNA Translation: AAK18176.1
AE014297 Genomic DNA Translation: AAF55673.2
AE014297 Genomic DNA Translation: AAF55675.2
AE014297 Genomic DNA Translation: ABI31176.1
AE014297 Genomic DNA Translation: ABI31178.1
AE014297 Genomic DNA Translation: ABI31180.1
RefSeqiNP_001036722.1, NM_001043257.2 [Q9VDW6-5]
NP_001036723.1, NM_001043258.2 [Q9VDW6-1]
NP_001036724.1, NM_001043259.2
NP_001036726.1, NM_001043261.2
NP_001036728.1, NM_001043263.2

3D structure databases

SMRiQ9VDW6
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi67322, 74 interactors
IntActiQ9VDW6, 39 interactors
STRINGi7227.FBpp0110219

PTM databases

iPTMnetiQ9VDW6

Proteomic databases

PaxDbiQ9VDW6
PRIDEiQ9VDW6

Genome annotation databases

EnsemblMetazoaiFBtr0083764; FBpp0083178; FBgn0260003 [Q9VDW6-1]
FBtr0110919; FBpp0110219; FBgn0260003 [Q9VDW6-5]
GeneIDi42327
UCSCiCG34157-RH, d. melanogaster

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
42327
FlyBaseiFBgn0260003, Dys

Phylogenomic databases

eggNOGiKOG4286, Eukaryota
GeneTreeiENSGT00940000166230
InParanoidiQ9VDW6
PhylomeDBiQ9VDW6

Enzyme and pathway databases

ReactomeiR-DME-114608, Platelet degranulation
R-DME-446388, Regulation of cytoskeletal remodeling and cell spreading by IPP complex components
SignaLinkiQ9VDW6

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
42327, 0 hits in 5 CRISPR screens

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
42327

Gene expression databases

BgeeiFBgn0260003, Expressed in spermathecum and 59 other tissues
ExpressionAtlasiQ9VDW6, baseline and differential
GenevisibleiQ9VDW6, DM

Family and domain databases

CDDicd00014, CH, 1 hit
cd00201, WW, 1 hit
Gene3Di1.10.418.10, 2 hits
3.30.60.90, 1 hit
InterProiView protein in InterPro
IPR001589, Actinin_actin-bd_CS
IPR001715, CH-domain
IPR036872, CH_dom_sf
IPR035436, Dystrophin/utrophin
IPR011992, EF-hand-dom_pair
IPR015153, EF-hand_dom_typ1
IPR015154, EF-hand_dom_typ2
IPR018159, Spectrin/alpha-actinin
IPR002017, Spectrin_repeat
IPR001202, WW_dom
IPR036020, WW_dom_sf
IPR000433, Znf_ZZ
IPR043145, Znf_ZZ_sf
PfamiView protein in Pfam
PF00307, CH, 2 hits
PF09068, EF-hand_2, 1 hit
PF09069, EF-hand_3, 1 hit
PF00435, Spectrin, 2 hits
PF00569, ZZ, 1 hit
PIRSFiPIRSF002341, Dystrophin/utrophin, 1 hit
SMARTiView protein in SMART
SM00033, CH, 2 hits
SM00150, SPEC, 11 hits
SM00456, WW, 1 hit
SM00291, ZnF_ZZ, 1 hit
SUPFAMiSSF47473, SSF47473, 2 hits
SSF47576, SSF47576, 1 hit
SSF51045, SSF51045, 1 hit
PROSITEiView protein in PROSITE
PS00019, ACTININ_1, 1 hit
PS00020, ACTININ_2, 1 hit
PS50021, CH, 2 hits
PS50020, WW_DOMAIN_2, 1 hit
PS01357, ZF_ZZ_1, 1 hit
PS50135, ZF_ZZ_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiDMDA_DROME
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9VDW6
Secondary accession number(s): Q0KI51
, Q0KI52, Q0KI53, Q9BK96, Q9BK98, Q9BKA0, Q9GT71, Q9VDW4
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 10, 2004
Last sequence update: March 3, 2009
Last modified: October 7, 2020
This is version 163 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Drosophila
    Drosophila: entries, gene names and cross-references to FlyBase
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again