Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 168 (26 Feb 2020)
Sequence version 1 (01 May 2000)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Protein 4.1 homolog

Gene

cora

Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

An integral component of the septate junction. May play a role in cell-cell interactions that are necessary for proper development. Vital for embryonic development.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDevelopmental protein

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-DME-6794361 Neurexins and neuroligins

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Protein 4.1 homolog
Alternative name(s):
Protein coracle
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:cora
ORF Names:CG11949
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiDrosophila melanogaster (Fruit fly)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri7227 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraHolometabolaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000803 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2R

Organism-specific databases

Drosophila genome database

More...
FlyBasei
FBgn0010434 cora

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell junction

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002193941 – 1698Protein 4.1 homologAdd BLAST1698

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei471Phosphoserine1 Publication1
Modified residuei474Phosphoserine1 Publication1
Modified residuei478Phosphoserine1 Publication1
Modified residuei566Phosphoserine1 Publication1
Modified residuei659Phosphoserine1 Publication1
Modified residuei687Phosphoserine1 Publication1
Modified residuei689Phosphothreonine1 Publication1
Modified residuei697Phosphoserine1 Publication1
Modified residuei1398Phosphoserine1 Publication1
Modified residuei1401Phosphoserine1 Publication1
Modified residuei1402Phosphoserine1 Publication1
Modified residuei1407Phosphothreonine1 Publication1
Modified residuei1590Phosphoserine1 Publication1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9V8R9

PeptideAtlas

More...
PeptideAtlasi
Q9V8R9

PRoteomics IDEntifications database

More...
PRIDEi
Q9V8R9

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9V8R9

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

At onset of germ band retraction, expression is seen in epidermis, hindgut and foregut. During retraction, expression extends to tracheal branches and salivary glands.

<p>This subsection of the 'Expression' section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified 'at the protein level'.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Expressed weakly in 4-8 hours embryos, more abundant expression in 8-12 hours and remains throughout later embryonic and larval stages.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
FBgn0010434 Expressed in embryo and 43 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9V8R9 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9V8R9 DM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
62870, 23 interactors

Database of interacting proteins

More...
DIPi
DIP-20283N

Protein interaction database and analysis system

More...
IntActi
Q9V8R9, 6 interactors

STRING: functional protein association networks

More...
STRINGi
7227.FBpp0085697

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9V8R9

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini32 – 314FERMPROSITE-ProRule annotationAdd BLAST283

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni317 – 434HydrophilicAdd BLAST118
Regioni1286 – 1698C-terminal (CTD)Add BLAST413

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi404 – 449Lys-richAdd BLAST46
Compositional biasi731 – 775Ala-richAdd BLAST45
Compositional biasi1437 – 1643Thr-richAdd BLAST207

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3527 Eukaryota
ENOG410Y7NQ LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000167098

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_002715_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9V8R9

KEGG Orthology (KO)

More...
KOi
K06107

Identification of Orthologs from Complete Genome Data

More...
OMAi
ESEDGMY

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9V8R9

Family and domain databases

Conserved Domains Database

More...
CDDi
cd14473 FERM_B-lobe, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.20.80.10, 1 hit
2.30.29.30, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR008379 Band_4.1_C
IPR019749 Band_41_domain
IPR014847 FERM-adjacent
IPR014352 FERM/acyl-CoA-bd_prot_sf
IPR035963 FERM_2
IPR019748 FERM_central
IPR019747 FERM_CS
IPR000299 FERM_domain
IPR018979 FERM_N
IPR018980 FERM_PH-like_C
IPR011993 PH-like_dom_sf
IPR029071 Ubiquitin-like_domsf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF05902 4_1_CTD, 1 hit
PF09380 FERM_C, 1 hit
PF00373 FERM_M, 1 hit
PF09379 FERM_N, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00935 BAND41

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00295 B41, 1 hit
SM01195 FA, 1 hit
SM01196 FERM_C, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF47031 SSF47031, 1 hit
SSF54236 SSF54236, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00661 FERM_2, 1 hit
PS50057 FERM_3, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 6 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9V8R9-1) [UniParc]FASTAAdd to basket
Also known as: A

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPAEIKPSAP AEPETPTKSK PKSSSSSHGK PALARVTLLD GSLLDVSIDR
60 70 80 90 100
KAIGRDVINS ICAGLNLIEK DYFGLTYETP TDPRTWLDLE KPVSKFFRTD
110 120 130 140 150
TWPLTFAVKF YPPEPSQLKE DITRYHLCLQ VRNDILEGRL PCTFVTHALL
160 170 180 190 200
GSYLVQSEMG DYDAEEMPTR AYLKDFKIAP NQTAELEDKV MDLHKTHKGQ
210 220 230 240 250
SPAEAELHYL ENAKKLAMYG VDLHPAKDSE GVDIMLGVCA SGLLVYRDKL
260 270 280 290 300
RINRFAWPKI LKISYKRHHF YIKIRPGEFE QYESTIGFKL ANHRAAKKLW
310 320 330 340 350
KSCVEHHTFF RLMTPEPVSK SKMFPVFGST YRYKGRTQAE STNTPVDRTP
360 370 380 390 400
PKFNRTLSGA RLTSRSMDAL ALAEKEKVAR KSSTLDHRGD RNADGDAHSR
410 420 430 440 450
SPIKNKKEKD ADKEAKLREK KQKEKEEKER KEREKRELEE KKKAEKAAKA
460 470 480 490 500
ALAAGAAAGA AVNGNDELND SNKSDKSSGR RGVGIFSSGR KSKSGSPSKD
510 520 530 540 550
GKDKSGKDKD KEVGRLGLVV TSGLGDNQQD QNLDEAARNA AKNRGSTTPG
560 570 580 590 600
VTRQYEYAVD NDGNTSPTRK SYTPGGFRYD QDPNSRKSGA DGQEQLSPTS
610 620 630 640 650
QQKKIGLAFN YAPGNENALK ETAEKLKAGQ LSPRTQDKLN RGQLSPKSRA
660 670 680 690 700
KLLQDPLLSP TTRAKLQGSA VDAAAVPLSD SQKRSYSPTK GPQGYSSGAP
710 720 730 740 750
GSYKPISDPT ADFLESQRYN KEPGYVGPSK ADVAAGLAGA AGSKKPGSPT
760 770 780 790 800
KTGKGAPGAA AAAAAGAAGA AAAAAKPKKR RVKIMVITSK FDPSTKRIDA
810 820 830 840 850
ENGSIEHSTG ILDPATGLID TKYGVIDPKK GTLEALNTKT GKKEVFQGDV
860 870 880 890 900
DGKTGNLHLV SGVADPKTGR LDDTLGQIVC ITPQDNPVVE LTVITSRIDP
910 920 930 940 950
ATGKIDTVNG DVERSLGVLN LDTGLLDTKY GEINTRTGEL KAIDPKSGKI
960 970 980 990 1000
VVSKNVKVDP GTGQITILGI VDPKTNKIDP NQGRLIEVGQ QIDPIVEVTS
1010 1020 1030 1040 1050
LAGKFDSKRN IIDPKTAQVE TSGGQFDPKA GKIDTKYGQI DLVKHTITFN
1060 1070 1080 1090 1100
DPKSGKTVTR DIKIEPTTGQ IVLKNQVNPK NNKPDKDYAR IISLRIVQQR
1110 1120 1130 1140 1150
VDPATKAPIT EVSASKDKDI VVDPKSNQIW VPTGATDPAT KEQQYISSSV
1160 1170 1180 1190 1200
DPKTGYVITI YGYLDPKTNE IKKQTKLDPN TIKIEPTSGK IYTATGEVDQ
1210 1220 1230 1240 1250
ATGEPLYAAT QVDPESGEVY TKLARVDPKT GKIVIVRILL ISKTDERGRP
1260 1270 1280 1290 1300
EEIDPSTCEI DPVSGRVLKF FNKTVYVYNM IDPVTGEIVQ VDPNDPRFAG
1310 1320 1330 1340 1350
ARTTVTHTMT LTGEIDPVTG RIKSEYGDID PNTGDIDPAT AVTDPVTGKL
1360 1370 1380 1390 1400
ILNYAQIDPS HFGKQAQVQT TTETVPITRQ QFFDGVKHIS KGALRRDSEG
1410 1420 1430 1440 1450
SSDDDMTAQY GADQVNEILI GSPAGQAGGK LGKPVSTPTV VKTTTKQVLT
1460 1470 1480 1490 1500
KNIDGVTHNV EEEVRNLGTG EVTYSTQEHK ADATPTDLSG AYVTATAVTT
1510 1520 1530 1540 1550
RTATTHEDLG KNAKTEQLEE KTVATTRTHD PNKQQQRVVT QEVKTTATVT
1560 1570 1580 1590 1600
SGDQYQRRDS VSSTSSGDSG TPIDGPYDGA SVVRTDNQKS PLFTTSATTG
1610 1620 1630 1640 1650
PHVESTRVVL GEDTPGFSGH GEIISTQTVS SKTRTVETIT YKTERDGIVE
1660 1670 1680 1690
TRVEQKITIQ SDGDPIDHDK ALAEAIQEAT AMNPDMTVEK IEIQQQTQ
Length:1,698
Mass (Da):184,168
Last modified:May 1, 2000 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i93940FC4F1ACEB83
GO
Isoform 2 (identifier: Q9V8R9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     409-409: K → KSSTGTASASSQSSLEGDYETNLEIEAIEAEPPVQ
     482-1290: Missing.
     1554-1587: Missing.
     1629-1635: VSSKTRT → GGGGGGI
     1636-1698: Missing.

Show »
Length:826
Mass (Da):90,597
Checksum:iEEEFF09B91EFDA70
GO
Isoform 3 (identifier: Q9V8R9-3) [UniParc]FASTAAdd to basket
Also known as: C

The sequence of this isoform differs from the canonical sequence as follows:
     409-409: K → KLMRQSSTGTASASSQSSLEGDYETNLEIEAIEAEPPVQ
     482-1480: Missing.
     1554-1587: Missing.

Show »
Length:703
Mass (Da):78,211
Checksum:iF205E1837F72875A
GO
Isoform 4 (identifier: Q9V8R9-4) [UniParc]FASTAAdd to basket
Also known as: B

The sequence of this isoform differs from the canonical sequence as follows:
     409-409: K → KSSTGTASASSQSSLEGDYETNLEIEAIEAEPPVQ
     482-1290: Missing.
     1554-1587: Missing.

Show »
Length:889
Mass (Da):97,999
Checksum:i97A79DB9F90021D2
GO
Isoform 5 (identifier: Q9V8R9-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-312: Missing.
     482-1480: Missing.

Show »
Length:387
Mass (Da):42,211
Checksum:i55F99F8A410F3CD3
GO
Isoform 6 (identifier: Q9V8R9-6) [UniParc]FASTAAdd to basket
Also known as: D

The sequence of this isoform differs from the canonical sequence as follows:
     482-1480: Missing.

Show »
Length:699
Mass (Da):77,759
Checksum:i972057E4972A47E3
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0B4LFX4A0A0B4LFX4_DROME
Coracle, isoform F
cora COR, Cor, cor, Cora, Coracle
1,600Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0B4LG23A0A0B4LG23_DROME
Coracle, isoform G
cora COR, Cor, cor, Cora, Coracle
1,696Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti970I → V in AAB59187 (PubMed:8162854).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0004741 – 312Missing in isoform 5. 1 PublicationAdd BLAST312
Alternative sequenceiVSP_000476409K → KSSTGTASASSQSSLEGDYE TNLEIEAIEAEPPVQ in isoform 2 and isoform 4. 1 Publication1
Alternative sequenceiVSP_000475409K → KLMRQSSTGTASASSQSSLE GDYETNLEIEAIEAEPPVQ in isoform 3. 2 Publications1
Alternative sequenceiVSP_000478482 – 1480Missing in isoform 3, isoform 5 and isoform 6. 3 PublicationsAdd BLAST999
Alternative sequenceiVSP_000477482 – 1290Missing in isoform 2 and isoform 4. 1 PublicationAdd BLAST809
Alternative sequenceiVSP_0004791554 – 1587Missing in isoform 2, isoform 3 and isoform 4. 2 PublicationsAdd BLAST34
Alternative sequenceiVSP_0004801629 – 1635VSSKTRT → GGGGGGI in isoform 2. 1 Publication7
Alternative sequenceiVSP_0004811636 – 1698Missing in isoform 2. 1 PublicationAdd BLAST63

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
L27467 mRNA Translation: AAB59187.1
L27468 mRNA Translation: AAA28742.1
L27469 mRNA Translation: AAA28743.1
AE013599 Genomic DNA Translation: AAF57591.1
AE013599 Genomic DNA Translation: AAF57592.1
AE013599 Genomic DNA Translation: AAF57593.1
AE013599 Genomic DNA Translation: AAM70846.1
AY070992 mRNA Translation: AAL48614.1
BT024976 mRNA Translation: ABE01206.1

Protein sequence database of the Protein Information Resource

More...
PIRi
T13800

NCBI Reference Sequences

More...
RefSeqi
NP_523791.2, NM_079067.4 [Q9V8R9-1]
NP_725864.1, NM_166336.2 [Q9V8R9-3]
NP_725865.1, NM_166337.2 [Q9V8R9-4]
NP_725866.1, NM_166338.3 [Q9V8R9-6]

Genome annotation databases

Ensembl metazoan genome annotation project

More...
EnsemblMetazoai
FBtr0086506; FBpp0085694; FBgn0010434 [Q9V8R9-3]
FBtr0086508; FBpp0085696; FBgn0010434 [Q9V8R9-4]
FBtr0086509; FBpp0085697; FBgn0010434 [Q9V8R9-1]
FBtr0301279; FBpp0290494; FBgn0010434 [Q9V8R9-6]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
37205

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
dme:Dmel_CG11949

UCSC genome browser

More...
UCSCi
CG11949-RA d. melanogaster

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L27467 mRNA Translation: AAB59187.1
L27468 mRNA Translation: AAA28742.1
L27469 mRNA Translation: AAA28743.1
AE013599 Genomic DNA Translation: AAF57591.1
AE013599 Genomic DNA Translation: AAF57592.1
AE013599 Genomic DNA Translation: AAF57593.1
AE013599 Genomic DNA Translation: AAM70846.1
AY070992 mRNA Translation: AAL48614.1
BT024976 mRNA Translation: ABE01206.1
PIRiT13800
RefSeqiNP_523791.2, NM_079067.4 [Q9V8R9-1]
NP_725864.1, NM_166336.2 [Q9V8R9-3]
NP_725865.1, NM_166337.2 [Q9V8R9-4]
NP_725866.1, NM_166338.3 [Q9V8R9-6]

3D structure databases

SMRiQ9V8R9
ModBaseiSearch...

Protein-protein interaction databases

BioGridi62870, 23 interactors
DIPiDIP-20283N
IntActiQ9V8R9, 6 interactors
STRINGi7227.FBpp0085697

PTM databases

iPTMnetiQ9V8R9

Proteomic databases

PaxDbiQ9V8R9
PeptideAtlasiQ9V8R9
PRIDEiQ9V8R9

Genome annotation databases

EnsemblMetazoaiFBtr0086506; FBpp0085694; FBgn0010434 [Q9V8R9-3]
FBtr0086508; FBpp0085696; FBgn0010434 [Q9V8R9-4]
FBtr0086509; FBpp0085697; FBgn0010434 [Q9V8R9-1]
FBtr0301279; FBpp0290494; FBgn0010434 [Q9V8R9-6]
GeneIDi37205
KEGGidme:Dmel_CG11949
UCSCiCG11949-RA d. melanogaster

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
37205
FlyBaseiFBgn0010434 cora

Phylogenomic databases

eggNOGiKOG3527 Eukaryota
ENOG410Y7NQ LUCA
GeneTreeiENSGT00940000167098
HOGENOMiCLU_002715_0_0_1
InParanoidiQ9V8R9
KOiK06107
OMAiESEDGMY
PhylomeDBiQ9V8R9

Enzyme and pathway databases

ReactomeiR-DME-6794361 Neurexins and neuroligins

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
cora fly

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
37205

Protein Ontology

More...
PROi
PR:Q9V8R9

Gene expression databases

BgeeiFBgn0010434 Expressed in embryo and 43 other tissues
ExpressionAtlasiQ9V8R9 baseline and differential
GenevisibleiQ9V8R9 DM

Family and domain databases

CDDicd14473 FERM_B-lobe, 1 hit
Gene3Di1.20.80.10, 1 hit
2.30.29.30, 1 hit
InterProiView protein in InterPro
IPR008379 Band_4.1_C
IPR019749 Band_41_domain
IPR014847 FERM-adjacent
IPR014352 FERM/acyl-CoA-bd_prot_sf
IPR035963 FERM_2
IPR019748 FERM_central
IPR019747 FERM_CS
IPR000299 FERM_domain
IPR018979 FERM_N
IPR018980 FERM_PH-like_C
IPR011993 PH-like_dom_sf
IPR029071 Ubiquitin-like_domsf
PfamiView protein in Pfam
PF05902 4_1_CTD, 1 hit
PF09380 FERM_C, 1 hit
PF00373 FERM_M, 1 hit
PF09379 FERM_N, 1 hit
PRINTSiPR00935 BAND41
SMARTiView protein in SMART
SM00295 B41, 1 hit
SM01195 FA, 1 hit
SM01196 FERM_C, 1 hit
SUPFAMiSSF47031 SSF47031, 1 hit
SSF54236 SSF54236, 1 hit
PROSITEiView protein in PROSITE
PS00661 FERM_2, 1 hit
PS50057 FERM_3, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry namei41_DROME
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9V8R9
Secondary accession number(s): A1ZBI0
, Q1WWD0, Q24440, Q24441, Q24442, Q9V8R8, Q9V8S0
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 2, 2002
Last sequence update: May 1, 2000
Last modified: February 26, 2020
This is version 168 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Drosophila
    Drosophila: entries, gene names and cross-references to FlyBase
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again