Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Brain-specific angiogenesis inhibitor 1-associated protein 2

Gene

BAIAP2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Adapter protein that links membrane-bound small G-proteins to cytoplasmic effector proteins. Necessary for CDC42-mediated reorganization of the actin cytoskeleton and for RAC1-mediated membrane ruffling. Involved in the regulation of the actin cytoskeleton by WASF family members and the Arp2/3 complex. Plays a role in neurite growth. Acts syngeristically with ENAH to promote filipodia formation. Plays a role in the reorganization of the actin cytoskeleton in response to bacterial infection. Participates in actin bundling when associated with EPS8, promoting filopodial protrusions.5 Publications

Caution

It is uncertain whether Met-1 or Met-59 is the initiator.Curated

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-2029482 Regulation of actin dynamics for phagocytic cup formation
R-HSA-4420097 VEGFA-VEGFR2 Pathway
R-HSA-5663213 RHO GTPases Activate WASPs and WAVEs

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
Q9UQB8

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q9UQB8

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Brain-specific angiogenesis inhibitor 1-associated protein 2
Short name:
BAI-associated protein 2
Short name:
BAI1-associated protein 2
Short name:
Protein BAP2
Alternative name(s):
Fas ligand-associated factor 3
Short name:
FLAF3
Insulin receptor substrate p53/p58
Short name:
IRS-58
Short name:
IRSp53/58
Insulin receptor substrate protein of 53 kDa
Short name:
IRSp53
Short name:
Insulin receptor substrate p53
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:BAIAP2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 17

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000175866.15

Human Gene Nomenclature Database

More...
HGNCi
HGNC:947 BAIAP2

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
605475 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9UQB8

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cell projection, Cytoplasm, Cytoskeleton, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi142K → E: Abolishes actin-bundling and filopodia formation; when associated with E-143; E-146 and E147. 1 Publication1
Mutagenesisi143K → E: Abolishes actin-bundling and filopodia formation; when associated with E-142; E-146 and E147. 1 Publication1
Mutagenesisi146K → E: Abolishes actin-bundling and filopodia formation; when associated with E-142; E-143 and E147. 1 Publication1
Mutagenesisi147K → E: Abolishes actin-bundling and filopodia formation; when associated with E-142; E-143 and E146. 1 Publication1
Mutagenesisi267I → N: Loss of interaction with CDC42. Loss of stimulation of neurite growth. 1 Publication1
Mutagenesisi413W → G: Impairs the SH3 domain and abolishes the interaction with EPS8. 1 Publication1
Mutagenesisi427F → A: Loss of interaction with ENAH and no induction of filopodia; when associated with A-428. 1 Publication1
Mutagenesisi428P → A: Loss of interaction with ENAH and no induction of filopodia; when associated with A-427. 1 Publication1

Organism-specific databases

DisGeNET

More...
DisGeNETi
10458

Open Targets

More...
OpenTargetsi
ENSG00000175866

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA25251

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
BAIAP2

Domain mapping of disease mutations (DMDM)

More...
DMDMi
73917636

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000648161 – 552Brain-specific angiogenesis inhibitor 1-associated protein 2Add BLAST552

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei261PhosphoserineCombined sources1
Modified residuei296PhosphothreonineCombined sources1
Modified residuei323PhosphoserineCombined sources1
Modified residuei325PhosphoserineCombined sources1
Modified residuei336PhosphoserineCombined sources1
Modified residuei340PhosphothreonineCombined sources1
Modified residuei346PhosphoserineCombined sources1
Modified residuei360PhosphothreonineCombined sources1
Modified residuei366PhosphoserineCombined sources1
Modified residuei384PhosphoserineCombined sources1
Modified residuei395PhosphoserineBy similarity1
Modified residuei454PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated on tyrosine residues by INSR in response to insulin treatment.1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9UQB8

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9UQB8

PeptideAtlas

More...
PeptideAtlasi
Q9UQB8

PRoteomics IDEntifications database

More...
PRIDEi
Q9UQB8

ProteomicsDB human proteome resource

More...
ProteomicsDBi
85532
85533 [Q9UQB8-2]
85534 [Q9UQB8-3]
85535 [Q9UQB8-4]
85536 [Q9UQB8-5]
85537 [Q9UQB8-6]

2D gel databases

University College Dublin 2-DE Proteome Database

More...
UCD-2DPAGEi
Q9UQB8

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9UQB8

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9UQB8

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Isoform 1 and isoform 4 are expressed almost exclusively in brain. Isoform 4 is barely detectable in placenta, prostate and testis. A short isoform is ubiquitous, with the highest expression in liver, prostate, testis and placenta.3 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000175866 Expressed in 194 organ(s), highest expression level in Brodmann (1909) area 10

CleanEx database of gene expression profiles

More...
CleanExi
HS_BAIAP2

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9UQB8 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9UQB8 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA023310
HPA027421

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer. Interacts with CDC42 and RAC1 that have been activated by GTP binding. Interacts with ATN1, ADGRB1, EPS8, SHANK1, SHANK2, SHANK3, WASF1 and WASF2. Interacts with ENAH after recruitment of CDC42. Interacts with TIAM1 and DIAPH1 (By similarity). Interacts (via SH3 domain) with E.coli effector protein EspF(U) (via PXXP motifs). Interacts with E.coli intimin receptor Tir.By similarity10 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
115721, 70 interactors

Database of interacting proteins

More...
DIPi
DIP-29272N

Protein interaction database and analysis system

More...
IntActi
Q9UQB8, 62 interactors

Molecular INTeraction database

More...
MINTi
Q9UQB8

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000316338

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1552
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q9UQB8

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9UQB8

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q9UQB8

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini1 – 250IMDPROSITE-ProRule annotationAdd BLAST250
Domaini374 – 437SH3PROSITE-ProRule annotationAdd BLAST64

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili132 – 153Sequence analysisAdd BLAST22

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The IMD domain forms a coiled coil. The isolated domain can induce actin bundling and filopodia formation. In the absence of G-proteins intramolecular interaction between the IMD and the SH3 domain gives rise to an auto-inhibited state of the protein. Interaction of the IMD with RAC1 or CDC42 leads to activation.1 Publication
The SH3 domain interacts with ATN1, ADGRB1, WASF1, WASF2, SHANK1, DIAPH1 and ENAH.1 Publication

Keywords - Domaini

Coiled coil, SH3 domain

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IKMM Eukaryota
ENOG41110CD LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000153560

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG054462

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9UQB8

KEGG Orthology (KO)

More...
KOi
K05627

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9UQB8

TreeFam database of animal gene trees

More...
TreeFami
TF325648

Family and domain databases

Conserved Domains Database

More...
CDDi
cd11915 SH3_Irsp53, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.20.1270.60, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR027267 AH/BAR_dom_sf
IPR013606 I-BAR_dom
IPR030128 IRSp53
IPR027681 IRSp53/IRTKS/Pinkbar
IPR035594 Irsp53_SH3
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain

The PANTHER Classification System

More...
PANTHERi
PTHR14206 PTHR14206, 1 hit
PTHR14206:SF3 PTHR14206:SF3, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF08397 IMD, 1 hit
PF14604 SH3_9, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00326 SH3, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF103657 SSF103657, 1 hit
SSF50044 SSF50044, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51338 IMD, 1 hit
PS50002 SH3, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 6 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 15 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9UQB8-1) [UniParc]FASTAAdd to basket
Also known as: IRSp53(L)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSLSRSEEMH RLTENVYKTI MEQFNPSLRN FIAMGKNYEK ALAGVTYAAK
60 70 80 90 100
GYFDALVKMG ELASESQGSK ELGDVLFQMA EVHRQIQNQL EEMLKSFHNE
110 120 130 140 150
LLTQLEQKVE LDSRYLSAAL KKYQTEQRSK GDALDKCQAE LKKLRKKSQG
160 170 180 190 200
SKNPQKYSDK ELQYIDAISN KQGELENYVS DGYKTALTEE RRRFCFLVEK
210 220 230 240 250
QCAVAKNSAA YHSKGKELLA QKLPLWQQAC ADPSKIPERA VQLMQQVASN
260 270 280 290 300
GATLPSALSA SKSNLVISDP IPGAKPLPVP PELAPFVGRM SAQESTPIMN
310 320 330 340 350
GVTGPDGEDY SPWADRKAAQ PKSLSPPQSQ SKLSDSYSNT LPVRKSVTPK
360 370 380 390 400
NSYATTENKT LPRSSSMAAG LERNGRMRVK AIFSHAAGDN STLLSFKEGD
410 420 430 440 450
LITLLVPEAR DGWHYGESEK TKMRGWFPFS YTRVLDSDGS DRLHMSLQQG
460 470 480 490 500
KSSSTGNLLD KDDLAIPPPD YGAASRAFPA QTASGFKQRP YSVAVPAFSQ
510 520 530 540 550
GLDDYGARSM SRNPFAHVQL KPTVTNDRCD LSAQGPEGRE HGDGSARTLA

GR
Length:552
Mass (Da):60,868
Last modified:May 1, 2000 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i3B9EDC6405DCC99D
GO
Isoform 2 (identifier: Q9UQB8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     529-552: CDLSAQGPEGREHGDGSARTLAGR → SAPLLS

Show »
Length:534
Mass (Da):59,014
Checksum:iE63C4C08C48964B7
GO
Isoform 3 (identifier: Q9UQB8-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     513-552: Missing.

Show »
Length:512
Mass (Da):56,626
Checksum:i985ACC2B8DBEE7C3
GO
Isoform 4 (identifier: Q9UQB8-4) [UniParc]FASTAAdd to basket
Also known as: BAIAP2-alpha

The sequence of this isoform differs from the canonical sequence as follows:
     512-552: RNPFAHVQLKPTVTNDRCDLSAQGPEGREHGDGSARTLAGR → SGSGTLVSTV

Show »
Length:521
Mass (Da):57,359
Checksum:i618A09FDBEB3A5C3
GO
Isoform 5 (identifier: Q9UQB8-5) [UniParc]FASTAAdd to basket
Also known as: BAIAP2-beta

The sequence of this isoform differs from the canonical sequence as follows:
     512-552: RNPFAHVQLKPTVTNDRCDLSAQGPEGREHGDGSARTLAGR → SADVEVARF

Show »
Length:520
Mass (Da):57,445
Checksum:iFC6852BB490F6C0B
GO
Isoform 6 (identifier: Q9UQB8-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     356-356: T → TA
     512-552: RNPFAHVQLKPTVTNDRCDLSAQGPEGREHGDGSARTLAGR → SGSGTLVSTV

Show »
Length:522
Mass (Da):57,430
Checksum:i58146A293AF313BC
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 15 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
I3L4C2I3L4C2_HUMAN
Brain-specific angiogenesis inhibit...
BAIAP2
553Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B4DWA1B4DWA1_HUMAN
Brain-specific angiogenesis inhibit...
BAIAP2
375Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
I3L3C6I3L3C6_HUMAN
Brain-specific angiogenesis inhibit...
BAIAP2
216Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
I3L2M4I3L2M4_HUMAN
Brain-specific angiogenesis inhibit...
BAIAP2
234Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
I3L3C5I3L3C5_HUMAN
Brain-specific angiogenesis inhibit...
BAIAP2
106Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
I3L0M4I3L0M4_HUMAN
Brain-specific angiogenesis inhibit...
BAIAP2
140Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
I3L125I3L125_HUMAN
Brain-specific angiogenesis inhibit...
BAIAP2
135Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
I3L327I3L327_HUMAN
Brain-specific angiogenesis inhibit...
BAIAP2
175Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
I3L526I3L526_HUMAN
Brain-specific angiogenesis inhibit...
BAIAP2
114Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
I3L2J6I3L2J6_HUMAN
Brain-specific angiogenesis inhibit...
BAIAP2
58Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There are more potential isoformsShow all

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti84R → W in BAD96390 (Ref. 4) Curated1
Sequence conflicti415Y → H in BAD96390 (Ref. 4) Curated1
Sequence conflicti473A → T in BAD96390 (Ref. 4) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_050686519Q → R. Corresponds to variant dbSNP:rs4969391Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_015502356T → TA in isoform 6. 2 Publications1
Alternative sequenceiVSP_015503512 – 552RNPFA…TLAGR → SGSGTLVSTV in isoform 4 and isoform 6. 4 PublicationsAdd BLAST41
Alternative sequenceiVSP_015504512 – 552RNPFA…TLAGR → SADVEVARF in isoform 5. 1 PublicationAdd BLAST41
Alternative sequenceiVSP_015505513 – 552Missing in isoform 3. 1 PublicationAdd BLAST40
Alternative sequenceiVSP_015506529 – 552CDLSA…TLAGR → SAPLLS in isoform 2. CuratedAdd BLAST24

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB015019 mRNA Translation: BAA36586.1
AB015020 mRNA Translation: BAA36587.1
AB017119 mRNA Translation: BAA74773.1
AB017120 mRNA Translation: BAA74774.1
AB104726 Genomic DNA Translation: BAC57945.1
AB104726 Genomic DNA Translation: BAC57946.1
AB104726 Genomic DNA Translation: BAC57947.1
AB104726 Genomic DNA Translation: BAC57948.1
AK222670 mRNA Translation: BAD96390.1
BC014020 mRNA Translation: AAH14020.1
BC032559 mRNA Translation: AAH32559.1
U70669 mRNA Translation: AAB93497.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS11775.1 [Q9UQB8-1]
CCDS11776.1 [Q9UQB8-5]
CCDS11777.1 [Q9UQB8-4]
CCDS45806.1 [Q9UQB8-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001138360.1, NM_001144888.1 [Q9UQB8-2]
NP_006331.1, NM_006340.2 [Q9UQB8-5]
NP_059344.1, NM_017450.2 [Q9UQB8-4]
NP_059345.1, NM_017451.2 [Q9UQB8-1]
XP_005257005.1, XM_005256948.3 [Q9UQB8-6]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.128316

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000321280; ENSP00000315685; ENSG00000175866 [Q9UQB8-4]
ENST00000321300; ENSP00000316338; ENSG00000175866 [Q9UQB8-1]
ENST00000428708; ENSP00000401022; ENSG00000175866 [Q9UQB8-2]
ENST00000435091; ENSP00000413069; ENSG00000175866 [Q9UQB8-5]
ENST00000575712; ENSP00000458964; ENSG00000175866 [Q9UQB8-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
10458

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:10458

UCSC genome browser

More...
UCSCi
uc002jyz.5 human [Q9UQB8-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB015019 mRNA Translation: BAA36586.1
AB015020 mRNA Translation: BAA36587.1
AB017119 mRNA Translation: BAA74773.1
AB017120 mRNA Translation: BAA74774.1
AB104726 Genomic DNA Translation: BAC57945.1
AB104726 Genomic DNA Translation: BAC57946.1
AB104726 Genomic DNA Translation: BAC57947.1
AB104726 Genomic DNA Translation: BAC57948.1
AK222670 mRNA Translation: BAD96390.1
BC014020 mRNA Translation: AAH14020.1
BC032559 mRNA Translation: AAH32559.1
U70669 mRNA Translation: AAB93497.1
CCDSiCCDS11775.1 [Q9UQB8-1]
CCDS11776.1 [Q9UQB8-5]
CCDS11777.1 [Q9UQB8-4]
CCDS45806.1 [Q9UQB8-2]
RefSeqiNP_001138360.1, NM_001144888.1 [Q9UQB8-2]
NP_006331.1, NM_006340.2 [Q9UQB8-5]
NP_059344.1, NM_017450.2 [Q9UQB8-4]
NP_059345.1, NM_017451.2 [Q9UQB8-1]
XP_005257005.1, XM_005256948.3 [Q9UQB8-6]
UniGeneiHs.128316

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1WDZX-ray2.63A/B1-228[»]
1Y2OX-ray2.20A/B1-250[»]
2YKTX-ray2.11A1-250[»]
3RNJX-ray1.50A375-436[»]
4JS0X-ray1.90B260-291[»]
6BD2X-ray2.90C335-372[»]
ProteinModelPortaliQ9UQB8
SMRiQ9UQB8
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi115721, 70 interactors
DIPiDIP-29272N
IntActiQ9UQB8, 62 interactors
MINTiQ9UQB8
STRINGi9606.ENSP00000316338

PTM databases

iPTMnetiQ9UQB8
PhosphoSitePlusiQ9UQB8

Polymorphism and mutation databases

BioMutaiBAIAP2
DMDMi73917636

2D gel databases

UCD-2DPAGEiQ9UQB8

Proteomic databases

EPDiQ9UQB8
PaxDbiQ9UQB8
PeptideAtlasiQ9UQB8
PRIDEiQ9UQB8
ProteomicsDBi85532
85533 [Q9UQB8-2]
85534 [Q9UQB8-3]
85535 [Q9UQB8-4]
85536 [Q9UQB8-5]
85537 [Q9UQB8-6]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
10458
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000321280; ENSP00000315685; ENSG00000175866 [Q9UQB8-4]
ENST00000321300; ENSP00000316338; ENSG00000175866 [Q9UQB8-1]
ENST00000428708; ENSP00000401022; ENSG00000175866 [Q9UQB8-2]
ENST00000435091; ENSP00000413069; ENSG00000175866 [Q9UQB8-5]
ENST00000575712; ENSP00000458964; ENSG00000175866 [Q9UQB8-3]
GeneIDi10458
KEGGihsa:10458
UCSCiuc002jyz.5 human [Q9UQB8-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
10458
DisGeNETi10458
EuPathDBiHostDB:ENSG00000175866.15

GeneCards: human genes, protein and diseases

More...
GeneCardsi
BAIAP2
HGNCiHGNC:947 BAIAP2
HPAiHPA023310
HPA027421
MIMi605475 gene
neXtProtiNX_Q9UQB8
OpenTargetsiENSG00000175866
PharmGKBiPA25251

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IKMM Eukaryota
ENOG41110CD LUCA
GeneTreeiENSGT00940000153560
HOVERGENiHBG054462
InParanoidiQ9UQB8
KOiK05627
PhylomeDBiQ9UQB8
TreeFamiTF325648

Enzyme and pathway databases

ReactomeiR-HSA-2029482 Regulation of actin dynamics for phagocytic cup formation
R-HSA-4420097 VEGFA-VEGFR2 Pathway
R-HSA-5663213 RHO GTPases Activate WASPs and WAVEs
SignaLinkiQ9UQB8
SIGNORiQ9UQB8

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
BAIAP2 human
EvolutionaryTraceiQ9UQB8

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
BAIAP2

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
10458

Protein Ontology

More...
PROi
PR:Q9UQB8

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000175866 Expressed in 194 organ(s), highest expression level in Brodmann (1909) area 10
CleanExiHS_BAIAP2
ExpressionAtlasiQ9UQB8 baseline and differential
GenevisibleiQ9UQB8 HS

Family and domain databases

CDDicd11915 SH3_Irsp53, 1 hit
Gene3Di1.20.1270.60, 1 hit
InterProiView protein in InterPro
IPR027267 AH/BAR_dom_sf
IPR013606 I-BAR_dom
IPR030128 IRSp53
IPR027681 IRSp53/IRTKS/Pinkbar
IPR035594 Irsp53_SH3
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain
PANTHERiPTHR14206 PTHR14206, 1 hit
PTHR14206:SF3 PTHR14206:SF3, 1 hit
PfamiView protein in Pfam
PF08397 IMD, 1 hit
PF14604 SH3_9, 1 hit
SMARTiView protein in SMART
SM00326 SH3, 1 hit
SUPFAMiSSF103657 SSF103657, 1 hit
SSF50044 SSF50044, 1 hit
PROSITEiView protein in PROSITE
PS51338 IMD, 1 hit
PS50002 SH3, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiBAIP2_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9UQB8
Secondary accession number(s): O43858
, Q53HB1, Q86WC1, Q8N5C0, Q96CR7, Q9UBR3, Q9UQ43
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 30, 2005
Last sequence update: May 1, 2000
Last modified: December 5, 2018
This is version 173 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again