Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
The new UniProt website is here! Take me to UniProt BETA

UniProtKB - Q9UQ88 (CD11A_HUMAN)

Entry version 201 (25 May 2022)
Sequence version 4 (11 Jan 2011)
Previous versions | rss
Add a publicationFeedback
Protein

Cyclin-dependent kinase 11A

Gene

CDK11A

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Appears to play multiple roles in cell cycle progression, cytokinesis and apoptosis. The p110 isoforms have been suggested to be involved in pre-mRNA splicing, potentially by phosphorylating the splicing protein SFRS7. The p58 isoform may act as a negative regulator of normal cell cycle progression.

2 Publications

Miscellaneous

Duplicated gene. CDK11A and CDK11B encode almost identical protein kinases of 110 kDa that contain at their C-termini the open reading frame of a smaller 58 kDa isoform which is expressed following IRES-mediated alternative initiation of translation.

Caution

Many references talk about 'p110 isoforms' but it is not yet known if this refers to CDK11A and/or CDK11B or one/some of the isoforms of each.Curated

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the 'Function' section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Mg2+

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Phosphorylation at Thr-436 or Tyr-437 inactivates the enzyme, while phosphorylation at Thr-583 activates it.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei455ATPPROSITE-ProRule annotation1
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei550Proton acceptorPROSITE-ProRule annotation1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi432 – 440ATPPROSITE-ProRule annotation9

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionKinase, Serine/threonine-protein kinase, Transferase
Biological processApoptosis, Cell cycle
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q9UQ88

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-380270, Recruitment of mitotic centrosome proteins and complexes

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...SignaLinki		Q9UQ88

SIGNOR Signaling Network Open Resource

More...SIGNORi		Q9UQ88

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Cyclin-dependent kinase 11A (EC:2.7.11.22)
Alternative name(s):
Cell division cycle 2-like protein kinase 2
Cell division protein kinase 11A
Galactosyltransferase-associated protein kinase p58/GTA
PITSLRE serine/threonine-protein kinase CDC2L2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CDK11A
Synonyms:CDC2L2, CDC2L3, PITSLREB
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:1730, CDK11A

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		116951, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q9UQ88

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000008128

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		728642

Open Targets

More...OpenTargetsi		ENSG00000008128

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA26263

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q9UQ88, Tchem

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...ChEMBLi		CHEMBL5416

DrugCentral

More...DrugCentrali		Q9UQ88

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		CDK11A

Domain mapping of disease mutations (DMDM)

More...DMDMi		317373559

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000243151 – 783Cyclin-dependent kinase 11AAdd BLAST783

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei47PhosphoserineBy similarity1
Modified residuei72PhosphoserineBy similarity1
Modified residuei271PhosphoserineBy similarity1
Modified residuei470Phosphoserine; by CDK7By similarity1
Modified residuei476Phosphothreonine; by CDK7By similarity1
Modified residuei577PhosphoserineBy similarity1
Modified residuei582PhosphotyrosineBy similarity1
Modified residuei583PhosphothreonineBy similarity1
Modified residuei739PhosphothreonineBy similarity1
Modified residuei740PhosphoserineBy similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

During apoptosis, induced by Fas or tumor necrosis factor, specific CKD11 p110 isoforms are cleaved by caspases to produce a protein (p110C) that contains the C-terminal kinase domain of the CDK11 proteins.

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q9UQ88

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q9UQ88

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q9UQ88

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q9UQ88

PeptideAtlas

More...PeptideAtlasi		Q9UQ88

PRoteomics IDEntifications database

More...PRIDEi		Q9UQ88

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		85520 [Q9UQ88-1]
85521 [Q9UQ88-10]
85522 [Q9UQ88-2]
85523 [Q9UQ88-3]
85524 [Q9UQ88-4]
85525 [Q9UQ88-5]
85526 [Q9UQ88-8]
85527 [Q9UQ88-9]

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...GlyGeni		Q9UQ88, 1 site, 1 O-linked glycan (1 site)

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q9UQ88

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q9UQ88

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed ubiquitously. Some evidence of isoform-specific tissue distribution.2 Publications

<p>This subsection of the 'Expression' section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

The p58 isoform is specifically induced in G2/M phase of the cell cycle.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000008128, Expressed in small intestine Peyer's patch and 114 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q9UQ88, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q9UQ88, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000008128, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

The cleaved p110 isoform, p110C, binds to the serine/threonine kinase PAK1. The p58 isoform but not the p110 isoform or p110C interacts with CCND3. The p110 isoforms are found in large molecular weight complexes containing CCNL1 and SFRS7.

2 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		609064, 112 interactors

ComplexPortal: manually curated resource of macromolecular complexes

More...ComplexPortali		CPX-341, Cyclin L1-CDK11A(p110) complex [Q9UQ88-1]
CPX-343, Cyclin L2-CDK11A(p110) complex [Q9UQ88-1]
CPX-344, Cyclin L1-CDK11A(p58) complex [Q9UQ88-10]
CPX-347, Cyclin L2-CDK11A(p58) complex [Q9UQ88-10]

Protein interaction database and analysis system

More...IntActi		Q9UQ88, 57 interactors

Molecular INTeraction database

More...MINTi		Q9UQ88

Chemistry databases

BindingDB database of measured binding affinities

More...BindingDBi		Q9UQ88

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q9UQ88, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

AlphaFold Protein Structure Database

More...AlphaFoldDBi		Q9UQ88

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q9UQ88

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini427 – 647Protein kinasePROSITE-ProRule annotationAdd BLAST221

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni18 – 396DisorderedSequence analysisAdd BLAST379
Regioni721 – 783DisorderedSequence analysisAdd BLAST63

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi18 – 83Basic and acidic residuesSequence analysisAdd BLAST66
Compositional biasi98 – 120Basic residuesSequence analysisAdd BLAST23
Compositional biasi121 – 239Basic and acidic residuesSequence analysisAdd BLAST119
Compositional biasi250 – 276Basic and acidic residuesSequence analysisAdd BLAST27
Compositional biasi288 – 350Acidic residuesSequence analysisAdd BLAST63
Compositional biasi351 – 370Basic and acidic residuesSequence analysisAdd BLAST20

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily.Curated

Phylogenomic databases

Ensembl GeneTree

More...GeneTreei		ENSGT00940000158459

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_000288_91_3_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q9UQ88

Identification of Orthologs from Complete Genome Data

More...OMAi		DSWHVKS

Database of Orthologous Groups

More...OrthoDBi		925637at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q9UQ88

TreeFam database of animal gene trees

More...TreeFami		TF101035

Family and domain databases

Conserved Domains Database

More...CDDi		cd07843, STKc_CDC2L1, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR045267, CDK11/PITSLRE_STKc
IPR011009, Kinase-like_dom_sf
IPR000719, Prot_kinase_dom
IPR008271, Ser/Thr_kinase_AS

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00069, Pkinase, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00220, S_TKc, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF56112, SSF56112, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50011, PROTEIN_KINASE_DOM, 1 hit
PS00108, PROTEIN_KINASE_ST, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (8+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 8 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing and alternative initiation. AlignAdd to basket
Note: Additional isoforms seem to exist.

This entry has 8 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform SV6 (identifier: Q9UQ88-1) [UniParc]FASTAAdd to basket
Also known as: p110

This isoform has been chosen as the <p><strong>What is the canonical sequence?</strong><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGDEKDSWKV KTLDEILQEK KRRKEQEEKA EIKRLKNSDD RDSKRDSLEE 
        60         70         80         90        100
GELRDHCMEI TIRNSPYRRE DSMEDRGEED DSLAIKPPQQ MSRKEKVHHR 
       110        120        130        140        150
KDEKRKEKWK HARVKEREHE RRKRHREEQD KARREWERQK RREMAREHSR 
       160        170        180        190        200
RERDRLEQLE RKRERERKMR EQQKEQREQK ERERRAEERR KEREARREVS 
       210        220        230        240        250
AHHRTMREDY SDKVKASHWS RSPPRPPRER FELGDGRKPG EARPAPAQKP 
       260        270        280        290        300
AQLKEEKMEE RDLLSDLQDI SDSERKTSSA ESSSAESGSG SEEEEEEEEE 
       310        320        330        340        350
EEEEGSTSEE SEEEEEEEEE EEEETGSNSE EASEQSAEEV SEEEMSEDEE 
       360        370        380        390        400
RENENHLLVV PESRFDRDSG ESEEAEEEVG EGTPQSSALT EGDYVPDSPA 
       410        420        430        440        450
LLPIELKQEL PKYLPALQGC RSVEEFQCLN RIEEGTYGVV YRAKDKKTDE 
       460        470        480        490        500
IVALKRLKME KEKEGFPITS LREINTILKA QHPNIVTVRE IVVGSNMDKI 
       510        520        530        540        550
YIVMNYVEHD LKSLMETMKQ PFLPGEVKTL MIQLLRGVKH LHDNWILHRD 
       560        570        580        590        600
LKTSNLLLSH AGILKVGDFG LAREYGSPLK AYTPVVVTQW YRAPELLLGA 
       610        620        630        640        650
KEYSTAVDMW SVGCIFGELL TQKPLFPGNS EIDQINKVFK ELGTPSEKIW 
       660        670        680        690        700
PGYSELPVVK KMTFSEHPYN NLRKRFGALL SDQGFDLMNK FLTYFPGRRI 
       710        720        730        740        750
SAEDGLKHEY FRETPLPIDP SMFPTWPAKS EQQRVKRGTS PRPPEGGLGY 
       760        770        780 
SQLGDDDLKE TGFHLTTTNQ GASAAGPGFS LKF
Length:783
Mass (Da):91,362
Last modified:January 11, 2011 - v4
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i1BCF67EB180F37C6
GO
Isoform SV1 (identifier: Q9UQ88-2) [UniParc]FASTAAdd to basket
Also known as: Pbeta21, Beta 2-1

The sequence of this isoform differs from the canonical sequence as follows:
     109-109: W → CRHHSHSAEGG
     240-253: GEARPAPAQKPAQL → V

Show »
Length:780
Mass (Da):91,018
Checksum:i5AA5206CBAFAA15B
GO
Isoform SV2 (identifier: Q9UQ88-3) [UniParc]FASTAAdd to basket
Also known as: Pbeta22

The sequence of this isoform differs from the canonical sequence as follows:
     153-153: R → RGNDGFCLFR
     240-253: GEARPAPAQKPAQL → V

Show »
Length:779
Mass (Da):91,055
Checksum:i519C680FC20A1250
GO
Isoform SV3 (identifier: Q9UQ88-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     240-253: GEARPAPAQKPAQL → V

Show »
Length:770
Mass (Da):90,045
Checksum:i44D5D04CACDB2519
GO
Isoform SV7 (identifier: Q9UQ88-5) [UniParc]FASTAAdd to basket
Also known as: SV8

The sequence of this isoform differs from the canonical sequence as follows:
     1-386: Missing.
     387-418: SALTEGDYVPDSPALLPIELKQELPKYLPALQ → MKNEKMKTTSWLFQSHGSTEIPGRVKKQRKKW

Show »
Length:397
Mass (Da):45,229
Checksum:i36B4BA8EE75D95C6
GO
Isoform SV12 (identifier: Q9UQ88-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-616: Missing.
     617-658: GELLTQKPLF...IWPGYSELPV → MGKTEEKGNG...QDAGAAEGAA

Show »
Length:167
Mass (Da):18,110
Checksum:iF769BDEC242A9044
GO
Isoform SV13 (identifier: Q9UQ88-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-57: Missing.
     153-153: R → RGNDGFCLFR
     240-253: GEARPAPAQKPAQL → V
     567-600: GDFGLAREYGSPLKAYTPVVVTQWYRAPELLLGA → SPPPSGPSQGDPPGPTHSRPSVVAGG
     601-783: Missing.

Show »
Length:531
Mass (Da):62,316
Checksum:i1BAA7CD839B07A06
GO
Isoform 4 (identifier: Q9UQ88-10) [UniParc]FASTAAdd to basket
Also known as: Beta 1, p58

The sequence of this isoform differs from the canonical sequence as follows:
     1-344: Missing.

Note: Produced by alternative initiation at Met-345 of isoform SV6.Curated
Show »
Length:439
Mass (Da):49,624
Checksum:i3DCA65216905266A
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q5QPR3Q5QPR3_HUMAN
Cyclin-dependent kinase 11A
CDK11A
779Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q5QPR4Q5QPR4_HUMAN
Cyclin-dependent kinase 11A
CDK11A
746Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PFJ2E9PFJ2_HUMAN
Cyclin-dependent kinase 11A
CDK11A
151Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E7ESP2E7ESP2_HUMAN
Cyclin-dependent kinase 11A
CDK11A
420Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3KS35J3KS35_HUMAN
Cyclin-dependent kinase 11A
CDK11A
407Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q5QPQ9Q5QPQ9_HUMAN
Cyclin-dependent kinase 11A
CDK11A
37Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAC95297 differs from that shown. Reason: Erroneous gene model prediction.Curated
The sequence AAC95298 differs from that shown. Reason: Erroneous gene model prediction.Curated
The sequence AAC95299 differs from that shown. Reason: Erroneous gene model prediction.Curated
The sequence AAC95300 differs from that shown. Reason: Erroneous gene model prediction.Curated
The sequence AAC95302 differs from that shown. Reason: Erroneous gene model prediction.Curated
The sequence AAC95303 differs from that shown. Reason: Erroneous gene model prediction.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti109Missing in AAA19594 (PubMed:8195233).Curated1
Sequence conflicti109Missing in AAA19595 (PubMed:8195233).Curated1
Sequence conflicti246P → R in AAC72087 (PubMed:9750192).Curated1
Sequence conflicti312 – 314Missing in AAA19594 (PubMed:8195233).Curated3
Sequence conflicti312 – 314Missing in AAA19595 (PubMed:8195233).Curated3
Sequence conflicti312 – 314Missing in AAC72084 (PubMed:9750192).Curated3
Sequence conflicti312 – 314Missing in AAC72085 (PubMed:9750192).Curated3
Sequence conflicti312 – 314Missing in AAC72086 (PubMed:9750192).Curated3
Sequence conflicti312 – 314Missing in AAC72087 (PubMed:9750192).Curated3
Sequence conflicti312 – 314Missing in AAC72090 (PubMed:9750192).Curated3
Sequence conflicti424E → D in AAA19585 (PubMed:8195233).Curated1
Sequence conflicti424E → D in AAA19594 (PubMed:8195233).Curated1
Sequence conflicti424E → D in AAA19595 (PubMed:8195233).Curated1
Sequence conflicti463K → N in AAA19585 (PubMed:8195233).Curated1
Sequence conflicti463K → N in AAA19594 (PubMed:8195233).Curated1
Sequence conflicti463K → N in AAA19595 (PubMed:8195233).Curated1
Sequence conflicti666E → R in AAA19585 (PubMed:8195233).Curated1
Sequence conflicti666E → R in AAA19594 (PubMed:8195233).Curated1
Sequence conflicti666E → R in AAA19595 (PubMed:8195233).Curated1
Sequence conflicti682D → E in AAA19585 (PubMed:8195233).Curated1
Sequence conflicti682D → E in AAA19594 (PubMed:8195233).Curated1
Sequence conflicti682D → E in AAA19595 (PubMed:8195233).Curated1
Isoform SV1 (identifier: Q9UQ88-2)
Sequence conflicti109C → R in AAA19594 (PubMed:8195233).Curated1
Sequence conflicti112H → R in AAA19594 (PubMed:8195233).Curated1
Isoform SV2 (identifier: Q9UQ88-3)
Sequence conflicti158F → V in AAA19595 (PubMed:8195233).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_06015257C → R. Corresponds to variant dbSNP:rs1059832Ensembl.1
Natural variantiVAR_06220092S → P. Corresponds to variant dbSNP:rs7531938Ensembl.1
Natural variantiVAR_03171693R → W2 PublicationsCorresponds to variant dbSNP:rs1059831Ensembl.1
Natural variantiVAR_031717402L → S1 PublicationCorresponds to variant dbSNP:rs1059828Ensembl.1
Natural variantiVAR_060153658V → A. Corresponds to variant dbSNP:rs866149312Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0082841 – 616Missing in isoform SV12. 1 PublicationAdd BLAST616
Alternative sequenceiVSP_0082831 – 386Missing in isoform SV7. 2 PublicationsAdd BLAST386
Alternative sequenceiVSP_0188361 – 344Missing in isoform 4. 1 PublicationAdd BLAST344
Alternative sequenceiVSP_0082811 – 57Missing in isoform SV13. 1 PublicationAdd BLAST57
Alternative sequenceiVSP_008286109W → CRHHSHSAEGG in isoform SV1. 2 Publications1
Alternative sequenceiVSP_008287153R → RGNDGFCLFR in isoform SV2 and isoform SV13. 2 Publications1
Alternative sequenceiVSP_008288240 – 253GEARP…KPAQL → V in isoform SV1, isoform SV2, isoform SV3 and isoform SV13. 2 PublicationsAdd BLAST14
Alternative sequenceiVSP_008289387 – 418SALTE…LPALQ → MKNEKMKTTSWLFQSHGSTE IPGRVKKQRKKW in isoform SV7. 2 PublicationsAdd BLAST32
Alternative sequenceiVSP_008290567 – 600GDFGL…LLLGA → SPPPSGPSQGDPPGPTHSRP SVVAGG in isoform SV13. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_008291601 – 783Missing in isoform SV13. 1 PublicationAdd BLAST183
Alternative sequenceiVSP_008292617 – 658GELLT…SELPV → MGKTEEKGNGKGAFQERKGP LGAVRKEAGAGAQDAGAAEG AA in isoform SV12. 1 PublicationAdd BLAST42

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
U04819 mRNA Translation: AAA19585.1
U07704 mRNA Translation: AAA19594.1
U07705 mRNA Translation: AAA19595.1
AF067518 mRNA Translation: AAC72083.1
AF067519 mRNA Translation: AAC72084.1
AF067520 mRNA Translation: AAC72085.1
AF067521 mRNA Translation: AAC72086.1
AF067522 mRNA Translation: AAC72087.1
AF067523 mRNA Translation: AAC72088.1
AF067524 mRNA Translation: AAC72089.1
AF067525 mRNA Translation: AAC72090.1
AF067526 mRNA Translation: AAC72091.1
AF067527 mRNA Translation: AAC72092.1
AF067528 mRNA Translation: AAC72093.1
AF067529 mRNA Translation: AAC72094.1
AF080694 AF080693 Genomic DNA Translation: AAC95297.1 Sequence problems.
AF080694 AF080693 Genomic DNA Translation: AAC95298.1 Sequence problems.
AF080694 AF080693 Genomic DNA Translation: AAC95299.1 Sequence problems.
AF080694 AF080693 Genomic DNA Translation: AAC95300.1 Sequence problems.
AF080697 AF080696 Genomic DNA Translation: AAC95302.1 Sequence problems.
AF080697 AF080696 Genomic DNA Translation: AAC95303.1 Sequence problems.
AL031282 Genomic DNA No translation available.
BC110905 mRNA Translation: AAI10906.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS44042.1 [Q9UQ88-2]
CCDS44043.1 [Q9UQ88-4]
CCDS81253.1 [Q9UQ88-1]
CCDS81254.1 [Q9UQ88-3]

Protein sequence database of the Protein Information Resource

More...PIRi		B54024
E54024
F54024
H54024

NCBI Reference Sequences

More...RefSeqi		NP_001300825.1, NM_001313896.1 [Q9UQ88-1]
NP_001300911.1, NM_001313982.1
NP_076916.2, NM_024011.3 [Q9UQ88-2]
NP_277071.2, NM_033529.3 [Q9UQ88-4]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000358779.9; ENSP00000351629.5; ENSG00000008128.23 [Q9UQ88-4]
ENST00000378633.5; ENSP00000367900.1; ENSG00000008128.23
ENST00000404249.8; ENSP00000384442.3; ENSG00000008128.23 [Q9UQ88-2]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		728642

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:728642

Matched Annotation from NCBI and EMBL-EBI (MANE) - Phase one

More...MANE-Selecti		ENST00000404249.8; ENSP00000384442.3; NM_024011.4; NP_076916.2 [Q9UQ88-2]

UCSC genome browser

More...UCSCi		uc009vkr.4, human [Q9UQ88-1]

Keywords - Coding sequence diversityi

Alternative initiation, Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U04819 mRNA Translation: AAA19585.1
U07704 mRNA Translation: AAA19594.1
U07705 mRNA Translation: AAA19595.1
AF067518 mRNA Translation: AAC72083.1
AF067519 mRNA Translation: AAC72084.1
AF067520 mRNA Translation: AAC72085.1
AF067521 mRNA Translation: AAC72086.1
AF067522 mRNA Translation: AAC72087.1
AF067523 mRNA Translation: AAC72088.1
AF067524 mRNA Translation: AAC72089.1
AF067525 mRNA Translation: AAC72090.1
AF067526 mRNA Translation: AAC72091.1
AF067527 mRNA Translation: AAC72092.1
AF067528 mRNA Translation: AAC72093.1
AF067529 mRNA Translation: AAC72094.1
AF080694 AF080693 Genomic DNA Translation: AAC95297.1 Sequence problems.
AF080694 AF080693 Genomic DNA Translation: AAC95298.1 Sequence problems.
AF080694 AF080693 Genomic DNA Translation: AAC95299.1 Sequence problems.
AF080694 AF080693 Genomic DNA Translation: AAC95300.1 Sequence problems.
AF080697 AF080696 Genomic DNA Translation: AAC95302.1 Sequence problems.
AF080697 AF080696 Genomic DNA Translation: AAC95303.1 Sequence problems.
AL031282 Genomic DNA No translation available.
BC110905 mRNA Translation: AAI10906.1
CCDSiCCDS44042.1 [Q9UQ88-2]
CCDS44043.1 [Q9UQ88-4]
CCDS81253.1 [Q9UQ88-1]
CCDS81254.1 [Q9UQ88-3]
PIRiB54024
E54024
F54024
H54024
RefSeqiNP_001300825.1, NM_001313896.1 [Q9UQ88-1]
NP_001300911.1, NM_001313982.1
NP_076916.2, NM_024011.3 [Q9UQ88-2]
NP_277071.2, NM_033529.3 [Q9UQ88-4]

3D structure databases

AlphaFoldDBiQ9UQ88
SMRiQ9UQ88
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi609064, 112 interactors
ComplexPortaliCPX-341, Cyclin L1-CDK11A(p110) complex [Q9UQ88-1]
CPX-343, Cyclin L2-CDK11A(p110) complex [Q9UQ88-1]
CPX-344, Cyclin L1-CDK11A(p58) complex [Q9UQ88-10]
CPX-347, Cyclin L2-CDK11A(p58) complex [Q9UQ88-10]
IntActiQ9UQ88, 57 interactors
MINTiQ9UQ88

Chemistry databases

BindingDBiQ9UQ88
ChEMBLiCHEMBL5416
DrugCentraliQ9UQ88

PTM databases

GlyGeniQ9UQ88, 1 site, 1 O-linked glycan (1 site)
iPTMnetiQ9UQ88
PhosphoSitePlusiQ9UQ88

Genetic variation databases

BioMutaiCDK11A
DMDMi317373559

Proteomic databases

EPDiQ9UQ88
jPOSTiQ9UQ88
MassIVEiQ9UQ88
MaxQBiQ9UQ88
PeptideAtlasiQ9UQ88
PRIDEiQ9UQ88
ProteomicsDBi85520 [Q9UQ88-1]
85521 [Q9UQ88-10]
85522 [Q9UQ88-2]
85523 [Q9UQ88-3]
85524 [Q9UQ88-4]
85525 [Q9UQ88-5]
85526 [Q9UQ88-8]
85527 [Q9UQ88-9]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		4184, 139 antibodies from 21 providers

The DNASU plasmid repository

More...DNASUi		728642

Genome annotation databases

EnsembliENST00000358779.9; ENSP00000351629.5; ENSG00000008128.23 [Q9UQ88-4]
ENST00000378633.5; ENSP00000367900.1; ENSG00000008128.23
ENST00000404249.8; ENSP00000384442.3; ENSG00000008128.23 [Q9UQ88-2]
GeneIDi728642
KEGGihsa:728642
MANE-SelectiENST00000404249.8; ENSP00000384442.3; NM_024011.4; NP_076916.2 [Q9UQ88-2]
UCSCiuc009vkr.4, human [Q9UQ88-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		728642
DisGeNETi728642

GeneCards: human genes, protein and diseases

More...GeneCardsi		CDK11A
HGNCiHGNC:1730, CDK11A
HPAiENSG00000008128, Low tissue specificity
MIMi116951, gene
neXtProtiNX_Q9UQ88
OpenTargetsiENSG00000008128
PharmGKBiPA26263
VEuPathDBiHostDB:ENSG00000008128

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

GeneTreeiENSGT00940000158459
HOGENOMiCLU_000288_91_3_1
InParanoidiQ9UQ88
OMAiDSWHVKS
OrthoDBi925637at2759
PhylomeDBiQ9UQ88
TreeFamiTF101035

Enzyme and pathway databases

PathwayCommonsiQ9UQ88
ReactomeiR-HSA-380270, Recruitment of mitotic centrosome proteins and complexes
SignaLinkiQ9UQ88
SIGNORiQ9UQ88

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		728642, 726 hits in 1110 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		CDK11A, human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		CDC2L2

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		728642
PharosiQ9UQ88, Tchem

Protein Ontology

More...PROi		PR:Q9UQ88
RNActiQ9UQ88, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000008128, Expressed in small intestine Peyer's patch and 114 other tissues
ExpressionAtlasiQ9UQ88, baseline and differential
GenevisibleiQ9UQ88, HS

Family and domain databases

CDDicd07843, STKc_CDC2L1, 1 hit
InterProiView protein in InterPro
IPR045267, CDK11/PITSLRE_STKc
IPR011009, Kinase-like_dom_sf
IPR000719, Prot_kinase_dom
IPR008271, Ser/Thr_kinase_AS
PfamiView protein in Pfam
PF00069, Pkinase, 1 hit
SMARTiView protein in SMART
SM00220, S_TKc, 1 hit
SUPFAMiSSF56112, SSF56112, 1 hit
PROSITEiView protein in PROSITE
PS50011, PROTEIN_KINASE_DOM, 1 hit
PS00108, PROTEIN_KINASE_ST, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCD11A_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9UQ88
Secondary accession number(s): O95227
, O95228, O96012, Q12821, Q12853, Q12854, Q2TAJ0, Q5QPR0, Q5QPR1, Q5QPR2, Q9UBC4, Q9UBI3, Q9UEI1, Q9UEI2, Q9UP53, Q9UP54, Q9UP55, Q9UP56, Q9UQ86, Q9UQ87, Q9UQ89
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 19, 2003
Last sequence update: January 11, 2011
Last modified: May 25, 2022
This is version 201 of the entry and version 4 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human and mouse protein kinases
    Human and mouse protein kinases: classification and index
  2. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  3. Human entries with genetic variants
    List of human entries with genetic variants
  4. Human variants curated from literature reports
    Index of human variants curated from literature reports
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again