Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Cyclin-dependent kinase 11A

Gene

CDK11A

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Appears to play multiple roles in cell cycle progression, cytokinesis and apoptosis. The p110 isoforms have been suggested to be involved in pre-mRNA splicing, potentially by phosphorylating the splicing protein SFRS7. The p58 isoform may act as a negative regulator of normal cell cycle progression.2 Publications

Miscellaneous

Duplicated gene. CDK11A and CDK11B encode almost identical protein kinases of 110 kDa that contain at their C-termini the open reading frame of a smaller 58 kDa isoform which is expressed following IRES-mediated alternative initiation of translation.

Caution

Many references talk about 'p110 isoforms' but it is not yet known if this refers to CDK11A and/or CDK11B or one/some of the isoforms of each.Curated

Catalytic activityi

ATP + a protein = ADP + a phosphoprotein.

Cofactori

Activity regulationi

Phosphorylation at Thr-436 or Tyr-437 inactivates the enzyme, while phosphorylation at Thr-583 activates it.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei455ATPPROSITE-ProRule annotation1
Active sitei550Proton acceptorPROSITE-ProRule annotation1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi432 – 440ATPPROSITE-ProRule annotation9

GO - Molecular functioni

  • ATP binding Source: UniProtKB
  • cyclin-dependent protein serine/threonine kinase activity Source: GO_Central
  • protein kinase activity Source: UniProtKB
  • protein serine/threonine kinase activity Source: UniProtKB

GO - Biological processi

Keywordsi

Molecular functionKinase, Serine/threonine-protein kinase, Transferase
Biological processApoptosis, Cell cycle
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

ReactomeiR-HSA-380270 Recruitment of mitotic centrosome proteins and complexes
SignaLinkiQ9UQ88
SIGNORiQ9UQ88

Names & Taxonomyi

Protein namesi
Recommended name:
Cyclin-dependent kinase 11A (EC:2.7.11.22)
Alternative name(s):
Cell division cycle 2-like protein kinase 2
Cell division protein kinase 11A
Galactosyltransferase-associated protein kinase p58/GTA
PITSLRE serine/threonine-protein kinase CDC2L2
Gene namesi
Name:CDK11A
Synonyms:CDC2L2, CDC2L3, PITSLREB
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

EuPathDBiHostDB:ENSG00000008128.22
HGNCiHGNC:1730 CDK11A
MIMi116951 gene
neXtProtiNX_Q9UQ88

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi728642
OpenTargetsiENSG00000008128
PharmGKBiPA26263

Chemistry databases

ChEMBLiCHEMBL5416

Polymorphism and mutation databases

BioMutaiCDK11A
DMDMi317373559

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000243151 – 783Cyclin-dependent kinase 11AAdd BLAST783

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei47PhosphoserineBy similarity1
Modified residuei72PhosphoserineBy similarity1
Modified residuei271PhosphoserineBy similarity1
Modified residuei470Phosphoserine; by CDK7By similarity1
Modified residuei476Phosphothreonine; by CDK7By similarity1
Modified residuei577PhosphoserineBy similarity1
Modified residuei582PhosphotyrosineBy similarity1
Modified residuei583PhosphothreonineBy similarity1
Modified residuei739PhosphothreonineBy similarity1
Modified residuei740PhosphoserineBy similarity1

Post-translational modificationi

During apoptosis, induced by Fas or tumor necrosis factor, specific CKD11 p110 isoforms are cleaved by caspases to produce a protein (p110C) that contains the C-terminal kinase domain of the CDK11 proteins.

Keywords - PTMi

Phosphoprotein

Proteomic databases

PeptideAtlasiQ9UQ88
PRIDEiQ9UQ88
ProteomicsDBi85520
85521 [Q9UQ88-10]
85522 [Q9UQ88-2]
85523 [Q9UQ88-3]
85524 [Q9UQ88-4]
85525 [Q9UQ88-5]
85526 [Q9UQ88-8]
85527 [Q9UQ88-9]

PTM databases

iPTMnetiQ9UQ88
PhosphoSitePlusiQ9UQ88

Expressioni

Tissue specificityi

Expressed ubiquitously. Some evidence of isoform-specific tissue distribution.2 Publications

Inductioni

The p58 isoform is specifically induced in G2/M phase of the cell cycle.1 Publication

Gene expression databases

BgeeiENSG00000008128 Expressed in 89 organ(s), highest expression level in small intestine Peyer's patch
ExpressionAtlasiQ9UQ88 baseline and differential
GenevisibleiQ9UQ88 HS

Organism-specific databases

HPAiCAB010467
HPA025061
HPA073626

Interactioni

Subunit structurei

The cleaved p110 isoform, p110C, binds to the serine/threonine kinase PAK1. The p58 isoform but not the p110 isoform or p110C interacts with CCND3. The p110 isoforms are found in large molecular weight complexes containing CCNL1 and SFRS7.2 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
CHEK2O960172EBI-11579223,EBI-1180783

Protein-protein interaction databases

BioGridi609064, 69 interactors
ComplexPortaliCPX-341 Cyclin L1-CDK11A(p110) complex [Q9UQ88-1]
CPX-343 Cyclin L2-CDK11A(p110) complex [Q9UQ88-1]
CPX-344 Cyclin L1-CDK11A(p58) complex [Q9UQ88-10]
CPX-347 Cyclin L2-CDK11A(p58) complex [Q9UQ88-10]
IntActiQ9UQ88, 33 interactors
MINTiQ9UQ88

Chemistry databases

BindingDBiQ9UQ88

Structurei

3D structure databases

ProteinModelPortaliQ9UQ88
SMRiQ9UQ88
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini427 – 647Protein kinasePROSITE-ProRule annotationAdd BLAST221

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi15 – 381Glu-richAdd BLAST367

Sequence similaritiesi

Phylogenomic databases

eggNOGiKOG0663 Eukaryota
ENOG410XQ50 LUCA
GeneTreeiENSGT00910000144030
HOVERGENiHBG014652
InParanoidiQ9UQ88
KOiK08818
OMAiCRIMHAD
OrthoDBiEOG091G048P
TreeFamiTF101035

Family and domain databases

InterProiView protein in InterPro
IPR011009 Kinase-like_dom_sf
IPR000719 Prot_kinase_dom
IPR008271 Ser/Thr_kinase_AS
PfamiView protein in Pfam
PF00069 Pkinase, 1 hit
SMARTiView protein in SMART
SM00220 S_TKc, 1 hit
SUPFAMiSSF56112 SSF56112, 1 hit
PROSITEiView protein in PROSITE
PS50011 PROTEIN_KINASE_DOM, 1 hit
PS00108 PROTEIN_KINASE_ST, 1 hit

Sequences (8+)i

Sequence statusi: Complete.

This entry describes 8 isoformsi produced by alternative splicing and alternative initiation. AlignAdd to basket
Note: Additional isoforms seem to exist.

This entry has 8 described isoforms and 6 potential isoforms that are computationally mapped.iShow all

Isoform SV6 (identifier: Q9UQ88-1) [UniParc]FASTAAdd to basket
Also known as: p110

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGDEKDSWKV KTLDEILQEK KRRKEQEEKA EIKRLKNSDD RDSKRDSLEE
60 70 80 90 100
GELRDHCMEI TIRNSPYRRE DSMEDRGEED DSLAIKPPQQ MSRKEKVHHR
110 120 130 140 150
KDEKRKEKWK HARVKEREHE RRKRHREEQD KARREWERQK RREMAREHSR
160 170 180 190 200
RERDRLEQLE RKRERERKMR EQQKEQREQK ERERRAEERR KEREARREVS
210 220 230 240 250
AHHRTMREDY SDKVKASHWS RSPPRPPRER FELGDGRKPG EARPAPAQKP
260 270 280 290 300
AQLKEEKMEE RDLLSDLQDI SDSERKTSSA ESSSAESGSG SEEEEEEEEE
310 320 330 340 350
EEEEGSTSEE SEEEEEEEEE EEEETGSNSE EASEQSAEEV SEEEMSEDEE
360 370 380 390 400
RENENHLLVV PESRFDRDSG ESEEAEEEVG EGTPQSSALT EGDYVPDSPA
410 420 430 440 450
LLPIELKQEL PKYLPALQGC RSVEEFQCLN RIEEGTYGVV YRAKDKKTDE
460 470 480 490 500
IVALKRLKME KEKEGFPITS LREINTILKA QHPNIVTVRE IVVGSNMDKI
510 520 530 540 550
YIVMNYVEHD LKSLMETMKQ PFLPGEVKTL MIQLLRGVKH LHDNWILHRD
560 570 580 590 600
LKTSNLLLSH AGILKVGDFG LAREYGSPLK AYTPVVVTQW YRAPELLLGA
610 620 630 640 650
KEYSTAVDMW SVGCIFGELL TQKPLFPGNS EIDQINKVFK ELGTPSEKIW
660 670 680 690 700
PGYSELPVVK KMTFSEHPYN NLRKRFGALL SDQGFDLMNK FLTYFPGRRI
710 720 730 740 750
SAEDGLKHEY FRETPLPIDP SMFPTWPAKS EQQRVKRGTS PRPPEGGLGY
760 770 780
SQLGDDDLKE TGFHLTTTNQ GASAAGPGFS LKF
Length:783
Mass (Da):91,362
Last modified:January 11, 2011 - v4
Checksum:i1BCF67EB180F37C6
GO
Isoform SV1 (identifier: Q9UQ88-2) [UniParc]FASTAAdd to basket
Also known as: Pbeta21, Beta 2-1

The sequence of this isoform differs from the canonical sequence as follows:
     109-109: W → CRHHSHSAEGG
     240-253: GEARPAPAQKPAQL → V

Show »
Length:780
Mass (Da):91,018
Checksum:i5AA5206CBAFAA15B
GO
Isoform SV2 (identifier: Q9UQ88-3) [UniParc]FASTAAdd to basket
Also known as: Pbeta22

The sequence of this isoform differs from the canonical sequence as follows:
     153-153: R → RGNDGFCLFR
     240-253: GEARPAPAQKPAQL → V

Show »
Length:779
Mass (Da):91,055
Checksum:i519C680FC20A1250
GO
Isoform SV3 (identifier: Q9UQ88-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     240-253: GEARPAPAQKPAQL → V

Show »
Length:770
Mass (Da):90,045
Checksum:i44D5D04CACDB2519
GO
Isoform SV7 (identifier: Q9UQ88-5) [UniParc]FASTAAdd to basket
Also known as: SV8

The sequence of this isoform differs from the canonical sequence as follows:
     1-386: Missing.
     387-418: SALTEGDYVPDSPALLPIELKQELPKYLPALQ → MKNEKMKTTSWLFQSHGSTEIPGRVKKQRKKW

Show »
Length:397
Mass (Da):45,229
Checksum:i36B4BA8EE75D95C6
GO
Isoform SV12 (identifier: Q9UQ88-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-616: Missing.
     617-658: GELLTQKPLF...IWPGYSELPV → MGKTEEKGNG...QDAGAAEGAA

Show »
Length:167
Mass (Da):18,110
Checksum:iF769BDEC242A9044
GO
Isoform SV13 (identifier: Q9UQ88-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-57: Missing.
     153-153: R → RGNDGFCLFR
     240-253: GEARPAPAQKPAQL → V
     567-600: GDFGLAREYGSPLKAYTPVVVTQWYRAPELLLGA → SPPPSGPSQGDPPGPTHSRPSVVAGG
     601-783: Missing.

Show »
Length:531
Mass (Da):62,316
Checksum:i1BAA7CD839B07A06
GO
Isoform 4 (identifier: Q9UQ88-10) [UniParc]FASTAAdd to basket
Also known as: Beta 1, p58

The sequence of this isoform differs from the canonical sequence as follows:
     1-344: Missing.

Note: Produced by alternative initiation at Met-345 of isoform SV6.
Show »
Length:439
Mass (Da):49,624
Checksum:i3DCA65216905266A
GO

Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q5QPR3Q5QPR3_HUMAN
Cyclin-dependent kinase 11A
CDK11A
779Annotation score:
Q5QPR4Q5QPR4_HUMAN
Cyclin-dependent kinase 11A
CDK11A
746Annotation score:
Q5QPQ9Q5QPQ9_HUMAN
Cyclin-dependent kinase 11A
CDK11A
37Annotation score:
J3KS35J3KS35_HUMAN
Cyclin-dependent kinase 11A
CDK11A
407Annotation score:
E7ESP2E7ESP2_HUMAN
Cyclin-dependent kinase 11A
CDK11A
420Annotation score:
E9PFJ2E9PFJ2_HUMAN
Cyclin-dependent kinase 11A
CDK11A
151Annotation score:

Sequence cautioni

The sequence AAC95297 differs from that shown. Reason: Erroneous gene model prediction.Curated
The sequence AAC95298 differs from that shown. Reason: Erroneous gene model prediction.Curated
The sequence AAC95299 differs from that shown. Reason: Erroneous gene model prediction.Curated
The sequence AAC95300 differs from that shown. Reason: Erroneous gene model prediction.Curated
The sequence AAC95302 differs from that shown. Reason: Erroneous gene model prediction.Curated
The sequence AAC95303 differs from that shown. Reason: Erroneous gene model prediction.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti109Missing in AAA19594 (PubMed:8195233).Curated1
Sequence conflicti109Missing in AAA19595 (PubMed:8195233).Curated1
Sequence conflicti246P → R in AAC72087 (PubMed:9750192).Curated1
Sequence conflicti312 – 314Missing in AAA19594 (PubMed:8195233).Curated3
Sequence conflicti312 – 314Missing in AAA19595 (PubMed:8195233).Curated3
Sequence conflicti312 – 314Missing in AAC72084 (PubMed:9750192).Curated3
Sequence conflicti312 – 314Missing in AAC72085 (PubMed:9750192).Curated3
Sequence conflicti312 – 314Missing in AAC72086 (PubMed:9750192).Curated3
Sequence conflicti312 – 314Missing in AAC72087 (PubMed:9750192).Curated3
Sequence conflicti312 – 314Missing in AAC72090 (PubMed:9750192).Curated3
Sequence conflicti424E → D in AAA19585 (PubMed:8195233).Curated1
Sequence conflicti424E → D in AAA19594 (PubMed:8195233).Curated1
Sequence conflicti424E → D in AAA19595 (PubMed:8195233).Curated1
Sequence conflicti463K → N in AAA19585 (PubMed:8195233).Curated1
Sequence conflicti463K → N in AAA19594 (PubMed:8195233).Curated1
Sequence conflicti463K → N in AAA19595 (PubMed:8195233).Curated1
Sequence conflicti666E → R in AAA19585 (PubMed:8195233).Curated1
Sequence conflicti666E → R in AAA19594 (PubMed:8195233).Curated1
Sequence conflicti666E → R in AAA19595 (PubMed:8195233).Curated1
Sequence conflicti682D → E in AAA19585 (PubMed:8195233).Curated1
Sequence conflicti682D → E in AAA19594 (PubMed:8195233).Curated1
Sequence conflicti682D → E in AAA19595 (PubMed:8195233).Curated1
Isoform SV1 (identifier: Q9UQ88-2)
Sequence conflicti109C → R in AAA19594 (PubMed:8195233).Curated1
Sequence conflicti112H → R in AAA19594 (PubMed:8195233).Curated1
Isoform SV2 (identifier: Q9UQ88-3)
Sequence conflicti158F → V in AAA19595 (PubMed:8195233).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_06015257C → R. Corresponds to variant dbSNP:rs1059832Ensembl.1
Natural variantiVAR_06220092S → P. Corresponds to variant dbSNP:rs7531938Ensembl.1
Natural variantiVAR_03171693R → W2 PublicationsCorresponds to variant dbSNP:rs1059831Ensembl.1
Natural variantiVAR_031717402L → S1 PublicationCorresponds to variant dbSNP:rs1059828Ensembl.1
Natural variantiVAR_060153658V → A. Corresponds to variant dbSNP:rs1059811Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0082841 – 616Missing in isoform SV12. 1 PublicationAdd BLAST616
Alternative sequenceiVSP_0082831 – 386Missing in isoform SV7. 2 PublicationsAdd BLAST386
Alternative sequenceiVSP_0188361 – 344Missing in isoform 4. 1 PublicationAdd BLAST344
Alternative sequenceiVSP_0082811 – 57Missing in isoform SV13. 1 PublicationAdd BLAST57
Alternative sequenceiVSP_008286109W → CRHHSHSAEGG in isoform SV1. 2 Publications1
Alternative sequenceiVSP_008287153R → RGNDGFCLFR in isoform SV2 and isoform SV13. 2 Publications1
Alternative sequenceiVSP_008288240 – 253GEARP…KPAQL → V in isoform SV1, isoform SV2, isoform SV3 and isoform SV13. 2 PublicationsAdd BLAST14
Alternative sequenceiVSP_008289387 – 418SALTE…LPALQ → MKNEKMKTTSWLFQSHGSTE IPGRVKKQRKKW in isoform SV7. 2 PublicationsAdd BLAST32
Alternative sequenceiVSP_008290567 – 600GDFGL…LLLGA → SPPPSGPSQGDPPGPTHSRP SVVAGG in isoform SV13. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_008291601 – 783Missing in isoform SV13. 1 PublicationAdd BLAST183
Alternative sequenceiVSP_008292617 – 658GELLT…SELPV → MGKTEEKGNGKGAFQERKGP LGAVRKEAGAGAQDAGAAEG AA in isoform SV12. 1 PublicationAdd BLAST42

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U04819 mRNA Translation: AAA19585.1
U07704 mRNA Translation: AAA19594.1
U07705 mRNA Translation: AAA19595.1
AF067518 mRNA Translation: AAC72083.1
AF067519 mRNA Translation: AAC72084.1
AF067520 mRNA Translation: AAC72085.1
AF067521 mRNA Translation: AAC72086.1
AF067522 mRNA Translation: AAC72087.1
AF067523 mRNA Translation: AAC72088.1
AF067524 mRNA Translation: AAC72089.1
AF067525 mRNA Translation: AAC72090.1
AF067526 mRNA Translation: AAC72091.1
AF067527 mRNA Translation: AAC72092.1
AF067528 mRNA Translation: AAC72093.1
AF067529 mRNA Translation: AAC72094.1
AF080694
, AF080695, AF105714, AF080696, AF080697, AF092427, AF092428, AF080689, AF080690, AF080691, AF080692, AF080693 Genomic DNA Translation: AAC95297.1 Sequence problems.
AF080694
, AF080695, AF105714, AF080696, AF080697, AF092427, AF092428, AF080689, AF080690, AF080691, AF080692, AF080693 Genomic DNA Translation: AAC95298.1 Sequence problems.
AF080694
, AF080695, AF105714, AF080696, AF080697, AF092427, AF092428, AF080689, AF080690, AF080691, AF080692, AF080693 Genomic DNA Translation: AAC95299.1 Sequence problems.
AF080694
, AF080695, AF105714, AF080696, AF080697, AF092427, AF092428, AF080689, AF080690, AF080691, AF080692, AF080693 Genomic DNA Translation: AAC95300.1 Sequence problems.
AF080697
, AF080695, AF105714, AF080696 Genomic DNA Translation: AAC95302.1 Sequence problems.
AF080697
, AF080695, AF105714, AF080696 Genomic DNA Translation: AAC95303.1 Sequence problems.
AL031282 Genomic DNA No translation available.
BC110905 mRNA Translation: AAI10906.1
CCDSiCCDS44042.1 [Q9UQ88-2]
CCDS44043.1 [Q9UQ88-4]
CCDS81253.1 [Q9UQ88-1]
CCDS81254.1 [Q9UQ88-3]
PIRiB54024
E54024
F54024
H54024
RefSeqiNP_001300825.1, NM_001313896.1 [Q9UQ88-1]
NP_001300911.1, NM_001313982.1
NP_076916.2, NM_024011.3 [Q9UQ88-2]
NP_277071.2, NM_033529.3 [Q9UQ88-4]
UniGeneiHs.651228
Hs.709182

Genome annotation databases

EnsembliENST00000358779; ENSP00000351629; ENSG00000008128 [Q9UQ88-4]
ENST00000378633; ENSP00000367900; ENSG00000008128 [Q9UQ88-1]
ENST00000404249; ENSP00000384442; ENSG00000008128 [Q9UQ88-2]
GeneIDi728642
KEGGihsa:728642
UCSCiuc009vkr.4 human [Q9UQ88-1]

Keywords - Coding sequence diversityi

Alternative initiation, Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiCD11A_HUMAN
AccessioniPrimary (citable) accession number: Q9UQ88
Secondary accession number(s): O95227
, O95228, O96012, Q12821, Q12853, Q12854, Q2TAJ0, Q5QPR0, Q5QPR1, Q5QPR2, Q9UBC4, Q9UBI3, Q9UEI1, Q9UEI2, Q9UP53, Q9UP54, Q9UP55, Q9UP56, Q9UQ86, Q9UQ87, Q9UQ89
Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 19, 2003
Last sequence update: January 11, 2011
Last modified: September 12, 2018
This is version 181 of the entry and version 4 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again