Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase B

Gene

MGAT4B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Glycosyltransferase that participates in the transfer of N-acetylglucosamine (GlcNAc) to the core mannose residues of N-linked glycans. Catalyzes the formation of the GlcNAcbeta1-4 branch on the GlcNAcbeta1-2Manalpha1-3 arm of the core structure of N-linked glycans. Essential for the production of tri- and tetra-antennary N-linked sugar chains. Has lower affinities for donors or acceptors than MGAT4A, suggesting that, under physiological conditions, it is not the main contributor in N-glycan biosynthesis.

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the ‘Function’ section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

<p>This subsection of the ‘Function’ section describes biophysical and chemical properties, such as maximal absorption, kinetic parameters, pH dependence, redox potentials and temperature dependence.<p><a href='/help/biophysicochemical_properties' target='_top'>More...</a></p>Kineticsi

  1. KM=0.242 mM for UDP-GlcNAc1 Publication

    <p>This subsection of the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: protein glycosylation

    This protein is involved in the pathway protein glycosylation, which is part of Protein modification.
    View all proteins of this organism that are known to be involved in the pathway protein glycosylation and in Protein modification.

    <p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

    GO - Biological processi

    • N-glycan processing Source: ProtInc
    • protein N-linked glycosylation Source: Ensembl

    <p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

    Molecular functionGlycosyltransferase, Transferase
    LigandMetal-binding

    Enzyme and pathway databases

    BioCyc Collection of Pathway/Genome Databases

    More...
    BioCyci
    MetaCyc:HS08564-MONOMER

    BRENDA Comprehensive Enzyme Information System

    More...
    BRENDAi
    2.4.1.145 2681

    Reactome - a knowledgebase of biological pathways and processes

    More...
    Reactomei
    R-HSA-975577 N-Glycan antennae elongation

    UniPathway: a resource for the exploration and annotation of metabolic pathways

    More...
    UniPathwayi
    UPA00378

    Protein family/group databases

    Carbohydrate-Active enZymes

    More...
    CAZyi
    GT54 Glycosyltransferase Family 54

    <p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
    Recommended name:
    Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase B (EC:2.4.1.145)
    Alternative name(s):
    N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase IVb
    Short name:
    GlcNAc-T IVb
    Short name:
    GnT-IVb
    Short name:
    N-acetylglucosaminyltransferase IVb
    UDP-N-acetylglucosamine: alpha-1,3-D-mannoside beta-1,4-N-acetylglucosaminyltransferase IVb
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
    Name:MGAT4B
    ORF Names:UNQ906/PRO1927
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
    • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 5

    Organism-specific databases

    Eukaryotic Pathogen Database Resources

    More...
    EuPathDBi
    HostDB:ENSG00000161013.16

    Human Gene Nomenclature Database

    More...
    HGNCi
    HGNC:7048 MGAT4B

    Online Mendelian Inheritance in Man (OMIM)

    More...
    MIMi
    604561 gene

    neXtProt; the human protein knowledge platform

    More...
    neXtProti
    NX_Q9UQ53

    <p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

    Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

    Topology

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 7CytoplasmicSequence analysis7
    <p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei8 – 28Helical; Signal-anchor for type II membrane proteinSequence analysisAdd BLAST21
    Topological domaini29 – 548LumenalSequence analysisAdd BLAST520

    Keywords - Cellular componenti

    Golgi apparatus, Membrane

    <p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

    Organism-specific databases

    DisGeNET

    More...
    DisGeNETi
    11282

    Open Targets

    More...
    OpenTargetsi
    ENSG00000161013

    The Pharmacogenetics and Pharmacogenomics Knowledge Base

    More...
    PharmGKBi
    PA30783

    Polymorphism and mutation databases

    BioMuta curated single-nucleotide variation and disease association database

    More...
    BioMutai
    MGAT4B

    Domain mapping of disease mutations (DMDM)

    More...
    DMDMi
    74735195

    <p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

    Molecule processing

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002885931 – 548Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase BAdd BLAST548

    Amino acid modifications

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi87N-linked (GlcNAc...) asparagineSequence analysis1
    Glycosylationi103N-linked (GlcNAc...) asparagineSequence analysis1

    Keywords - PTMi

    Glycoprotein

    Proteomic databases

    Encyclopedia of Proteome Dynamics

    More...
    EPDi
    Q9UQ53

    PaxDb, a database of protein abundance averages across all three domains of life

    More...
    PaxDbi
    Q9UQ53

    PeptideAtlas

    More...
    PeptideAtlasi
    Q9UQ53

    PRoteomics IDEntifications database

    More...
    PRIDEi
    Q9UQ53

    ProteomicsDB human proteome resource

    More...
    ProteomicsDBi
    85509
    85510 [Q9UQ53-2]
    85511 [Q9UQ53-3]

    PTM databases

    iPTMnet integrated resource for PTMs in systems biology context

    More...
    iPTMneti
    Q9UQ53

    Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

    More...
    PhosphoSitePlusi
    Q9UQ53

    <p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

    <p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

    Widely expressed. Strongly overexpressed in pancreatic cancer.1 Publication

    Gene expression databases

    Bgee dataBase for Gene Expression Evolution

    More...
    Bgeei
    ENSG00000161013 Expressed in 209 organ(s), highest expression level in mucosa of transverse colon

    CleanEx database of gene expression profiles

    More...
    CleanExi
    HS_MGAT4B

    ExpressionAtlas, Differential and Baseline Expression

    More...
    ExpressionAtlasi
    Q9UQ53 baseline and differential

    Genevisible search portal to normalized and curated expression data from Genevestigator

    More...
    Genevisiblei
    Q9UQ53 HS

    Organism-specific databases

    Human Protein Atlas

    More...
    HPAi
    HPA052134

    <p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

    Protein-protein interaction databases

    The Biological General Repository for Interaction Datasets (BioGrid)

    More...
    BioGridi
    116438, 10 interactors

    CORUM comprehensive resource of mammalian protein complexes

    More...
    CORUMi
    Q9UQ53

    Protein interaction database and analysis system

    More...
    IntActi
    Q9UQ53, 3 interactors

    STRING: functional protein association networks

    More...
    STRINGi
    9606.ENSP00000338487

    <p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

    3D structure databases

    Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

    More...
    ProteinModelPortali
    Q9UQ53

    Database of comparative protein structure models

    More...
    ModBasei
    Search...

    MobiDB: a database of protein disorder and mobility annotations

    More...
    MobiDBi
    Search...

    <p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

    Coiled coil

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili36 – 83Sequence analysisAdd BLAST48

    <p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

    Belongs to the glycosyltransferase 54 family.Curated

    Keywords - Domaini

    Coiled coil, Signal-anchor, Transmembrane, Transmembrane helix

    Phylogenomic databases

    evolutionary genealogy of genes: Non-supervised Orthologous Groups

    More...
    eggNOGi
    ENOG410IEDC Eukaryota
    ENOG410XPV0 LUCA

    Ensembl GeneTree

    More...
    GeneTreei
    ENSGT00940000156526

    The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

    More...
    HOGENOMi
    HOG000015085

    The HOVERGEN Database of Homologous Vertebrate Genes

    More...
    HOVERGENi
    HBG053194

    InParanoid: Eukaryotic Ortholog Groups

    More...
    InParanoidi
    Q9UQ53

    KEGG Orthology (KO)

    More...
    KOi
    K00738

    Identification of Orthologs from Complete Genome Data

    More...
    OMAi
    LKLWNIT

    Database of Orthologous Groups

    More...
    OrthoDBi
    EOG091G06KB

    Database for complete collections of gene phylogenies

    More...
    PhylomeDBi
    Q9UQ53

    TreeFam database of animal gene trees

    More...
    TreeFami
    TF324570

    Family and domain databases

    Integrated resource of protein families, domains and functional sites

    More...
    InterProi
    View protein in InterPro
    IPR006759 Glyco_transf_54

    The PANTHER Classification System

    More...
    PANTHERi
    PTHR12062 PTHR12062, 1 hit

    <p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

    <p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

    This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

    This entry has 3 described isoforms and 9 potential isoforms that are computationally mapped.Show allAlign All

    Isoform 1 (identifier: Q9UQ53-1) [UniParc]FASTAAdd to basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide
            10         20         30         40         50
    MRLRNGTFLT LLLFCLCAFL SLSWYAALSG QKGDVVDVYQ REFLALRDRL
    60 70 80 90 100
    HAAEQESLKR SKELNLVLDE IKRAVSERQA LRDGDGNRTW GRLTEDPRLK
    110 120 130 140 150
    PWNGSHRHVL HLPTVFHHLP HLLAKESSLQ PAVRVGQGRT GVSVVMGIPS
    160 170 180 190 200
    VRREVHSYLT DTLHSLISEL SPQEKEDSVI VVLIAETDSQ YTSAVTENIK
    210 220 230 240 250
    ALFPTEIHSG LLEVISPSPH FYPDFSRLRE SFGDPKERVR WRTKQNLDYC
    260 270 280 290 300
    FLMMYAQSKG IYYVQLEDDI VAKPNYLSTM KNFALQQPSE DWMILEFSQL
    310 320 330 340 350
    GFIGKMFKSL DLSLIVEFIL MFYRDKPIDW LLDHILWVKV CNPEKDAKHC
    360 370 380 390 400
    DRQKANLRIR FKPSLFQHVG THSSLAGKIQ KLKDKDFGKQ ALRKEHVNPP
    410 420 430 440 450
    AEVSTSLKTY QHFTLEKAYL REDFFWAFTP AAGDFIRFRF FQPLRLERFF
    460 470 480 490 500
    FRSGNIEHPE DKLFNTSVEV LPFDNPQSDK EALQEGRTAT LRYPRSPDGY
    510 520 530 540
    LQIGSFYKGV AEGEVDPAFG PLEALRLSIQ TDSPVWVILS EIFLKKAD
    Length:548
    Mass (Da):63,198
    Last modified:May 1, 2000 - v1
    <p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i1EFF2E681D683C4D
    GO
    Isoform 2 (identifier: Q9UQ53-2) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         348-348: Missing.

    Note: No experimental confirmation available.
    Show »
    Length:547
    Mass (Da):63,070
    Checksum:i20752291F5255E6C
    GO
    Isoform 3 (identifier: Q9UQ53-3) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-32: MRLRNGTFLTLLLFCLCAFLSLSWYAALSGQK → MSRVAGTRTD...PLVTACLPPA

    Note: No experimental confirmation available.
    Show »
    Length:563
    Mass (Da):64,845
    Checksum:iBBEB51190B4F1873
    GO

    <p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

    There are 9 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
    EntryEntry nameProtein names
    Gene namesLengthAnnotation
    H0YC56H0YC56_HUMAN
    Alpha-1,3-mannosyl-glycoprotein 4-b...
    MGAT4B
    150Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    E5RFL0E5RFL0_HUMAN
    Alpha-1,3-mannosyl-glycoprotein 4-b...
    MGAT4B
    157Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    E5RFS3E5RFS3_HUMAN
    Alpha-1,3-mannosyl-glycoprotein 4-b...
    MGAT4B
    200Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    H0YC13H0YC13_HUMAN
    Alpha-1,3-mannosyl-glycoprotein 4-b...
    MGAT4B
    322Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    H0YC79H0YC79_HUMAN
    Alpha-1,3-mannosyl-glycoprotein 4-b...
    MGAT4B
    307Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    H0YB89H0YB89_HUMAN
    Alpha-1,3-mannosyl-glycoprotein 4-b...
    MGAT4B
    240Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    H0YB84H0YB84_HUMAN
    Alpha-1,3-mannosyl-glycoprotein 4-b...
    MGAT4B
    373Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    H0YC11H0YC11_HUMAN
    Alpha-1,3-mannosyl-glycoprotein 4-b...
    MGAT4B
    429Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    H0YB63H0YB63_HUMAN
    Alpha-1,3-mannosyl-glycoprotein 4-b...
    MGAT4B
    244Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

    Natural variant

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_053913257Q → H. Corresponds to variant dbSNP:rs190631Ensembl.1
    Natural variantiVAR_032446491L → F1 PublicationCorresponds to variant dbSNP:rs17854722Ensembl.1

    Alternative sequence

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0432311 – 32MRLRN…LSGQK → MSRVAGTRTDVNELLQRWTP RCVRWHTGGARRVALDRPLV TACLPPA in isoform 3. 1 PublicationAdd BLAST32
    Alternative sequenceiVSP_025716348Missing in isoform 2. 1 Publication1

    Sequence databases

    Select the link destinations:

    EMBL nucleotide sequence database

    More...
    EMBLi

    GenBank nucleotide sequence database

    More...
    GenBanki

    DNA Data Bank of Japan; a nucleotide sequence database

    More...
    DDBJi
    Links Updated
    AB000624 mRNA Translation: BAA83464.1
    AY358984 mRNA Translation: AAQ89343.1
    AK023137 mRNA Translation: BAG51162.1
    AC008393 Genomic DNA No translation available.
    CH471165 Genomic DNA Translation: EAW53791.1
    BC009464 mRNA Translation: AAH09464.2
    BC051835 mRNA Translation: AAH51835.1
    AL162067 mRNA Translation: CAB82404.2

    The Consensus CDS (CCDS) project

    More...
    CCDSi
    CCDS4448.1 [Q9UQ53-1]
    CCDS4449.1 [Q9UQ53-3]

    Protein sequence database of the Protein Information Resource

    More...
    PIRi
    T47170

    NCBI Reference Sequences

    More...
    RefSeqi
    NP_055090.1, NM_014275.4 [Q9UQ53-1]
    NP_463459.1, NM_054013.3 [Q9UQ53-3]

    UniGene gene-oriented nucleotide sequence clusters

    More...
    UniGenei
    Hs.567419

    Genome annotation databases

    Ensembl eukaryotic genome annotation project

    More...
    Ensembli
    ENST00000292591; ENSP00000292591; ENSG00000161013 [Q9UQ53-1]
    ENST00000337755; ENSP00000338487; ENSG00000161013 [Q9UQ53-3]
    ENST00000638266; ENSP00000492708; ENSG00000284501 [Q9UQ53-1]
    ENST00000639538; ENSP00000491766; ENSG00000284501 [Q9UQ53-3]

    Database of genes from NCBI RefSeq genomes

    More...
    GeneIDi
    11282

    KEGG: Kyoto Encyclopedia of Genes and Genomes

    More...
    KEGGi
    hsa:11282

    UCSC genome browser

    More...
    UCSCi
    uc003mkr.4 human [Q9UQ53-1]

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    <p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

    <p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBLi
    GenBanki
    DDBJi
    Links Updated
    AB000624 mRNA Translation: BAA83464.1
    AY358984 mRNA Translation: AAQ89343.1
    AK023137 mRNA Translation: BAG51162.1
    AC008393 Genomic DNA No translation available.
    CH471165 Genomic DNA Translation: EAW53791.1
    BC009464 mRNA Translation: AAH09464.2
    BC051835 mRNA Translation: AAH51835.1
    AL162067 mRNA Translation: CAB82404.2
    CCDSiCCDS4448.1 [Q9UQ53-1]
    CCDS4449.1 [Q9UQ53-3]
    PIRiT47170
    RefSeqiNP_055090.1, NM_014275.4 [Q9UQ53-1]
    NP_463459.1, NM_054013.3 [Q9UQ53-3]
    UniGeneiHs.567419

    3D structure databases

    ProteinModelPortaliQ9UQ53
    ModBaseiSearch...
    MobiDBiSearch...

    Protein-protein interaction databases

    BioGridi116438, 10 interactors
    CORUMiQ9UQ53
    IntActiQ9UQ53, 3 interactors
    STRINGi9606.ENSP00000338487

    Protein family/group databases

    CAZyiGT54 Glycosyltransferase Family 54

    PTM databases

    iPTMnetiQ9UQ53
    PhosphoSitePlusiQ9UQ53

    Polymorphism and mutation databases

    BioMutaiMGAT4B
    DMDMi74735195

    Proteomic databases

    EPDiQ9UQ53
    PaxDbiQ9UQ53
    PeptideAtlasiQ9UQ53
    PRIDEiQ9UQ53
    ProteomicsDBi85509
    85510 [Q9UQ53-2]
    85511 [Q9UQ53-3]

    Protocols and materials databases

    The DNASU plasmid repository

    More...
    DNASUi
    11282
    Structural Biology KnowledgebaseSearch...

    Genome annotation databases

    EnsembliENST00000292591; ENSP00000292591; ENSG00000161013 [Q9UQ53-1]
    ENST00000337755; ENSP00000338487; ENSG00000161013 [Q9UQ53-3]
    ENST00000638266; ENSP00000492708; ENSG00000284501 [Q9UQ53-1]
    ENST00000639538; ENSP00000491766; ENSG00000284501 [Q9UQ53-3]
    GeneIDi11282
    KEGGihsa:11282
    UCSCiuc003mkr.4 human [Q9UQ53-1]

    Organism-specific databases

    Comparative Toxicogenomics Database

    More...
    CTDi
    11282
    DisGeNETi11282
    EuPathDBiHostDB:ENSG00000161013.16

    GeneCards: human genes, protein and diseases

    More...
    GeneCardsi
    MGAT4B
    HGNCiHGNC:7048 MGAT4B
    HPAiHPA052134
    MIMi604561 gene
    neXtProtiNX_Q9UQ53
    OpenTargetsiENSG00000161013
    PharmGKBiPA30783

    GenAtlas: human gene database

    More...
    GenAtlasi
    Search...

    Phylogenomic databases

    eggNOGiENOG410IEDC Eukaryota
    ENOG410XPV0 LUCA
    GeneTreeiENSGT00940000156526
    HOGENOMiHOG000015085
    HOVERGENiHBG053194
    InParanoidiQ9UQ53
    KOiK00738
    OMAiLKLWNIT
    OrthoDBiEOG091G06KB
    PhylomeDBiQ9UQ53
    TreeFamiTF324570

    Enzyme and pathway databases

    UniPathwayi
    UPA00378

    BioCyciMetaCyc:HS08564-MONOMER
    BRENDAi2.4.1.145 2681
    ReactomeiR-HSA-975577 N-Glycan antennae elongation

    Miscellaneous databases

    ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

    More...
    ChiTaRSi
    MGAT4B human

    The Gene Wiki collection of pages on human genes and proteins

    More...
    GeneWikii
    MGAT4B

    Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

    More...
    GenomeRNAii
    11282

    Protein Ontology

    More...
    PROi
    PR:Q9UQ53

    The Stanford Online Universal Resource for Clones and ESTs

    More...
    SOURCEi
    Search...

    Gene expression databases

    BgeeiENSG00000161013 Expressed in 209 organ(s), highest expression level in mucosa of transverse colon
    CleanExiHS_MGAT4B
    ExpressionAtlasiQ9UQ53 baseline and differential
    GenevisibleiQ9UQ53 HS

    Family and domain databases

    InterProiView protein in InterPro
    IPR006759 Glyco_transf_54
    PANTHERiPTHR12062 PTHR12062, 1 hit

    ProtoNet; Automatic hierarchical classification of proteins

    More...
    ProtoNeti
    Search...

    <p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

    <p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMGT4B_HUMAN
    <p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9UQ53
    Secondary accession number(s): A8MPR0
    , Q86TF1, Q96GH4, Q9NSK6
    <p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 29, 2007
    Last sequence update: May 1, 2000
    Last modified: December 5, 2018
    This is version 131 of the entry and version 1 of the sequence. See complete history.
    <p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    <p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. SIMILARITY comments
      Index of protein domains and families
    2. Human chromosome 5
      Human chromosome 5: entries, gene names and cross-references to MIM
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. PATHWAY comments
      Index of metabolic and biosynthesis pathways
    5. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    6. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    UniProt is an ELIXIR core data resource
    Main funding by: National Institutes of Health

    We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

    Do not show this banner again