Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase B

Gene

MGAT4B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Glycosyltransferase that participates in the transfer of N-acetylglucosamine (GlcNAc) to the core mannose residues of N-linked glycans. Catalyzes the formation of the GlcNAcbeta1-4 branch on the GlcNAcbeta1-2Manalpha1-3 arm of the core structure of N-linked glycans. Essential for the production of tri- and tetra-antennary N-linked sugar chains. Has lower affinities for donors or acceptors than MGAT4A, suggesting that, under physiological conditions, it is not the main contributor in N-glycan biosynthesis.

Catalytic activityi

UDP-N-acetyl-alpha-D-glucosamine + beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->3)-(beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->6))-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-beta-D-GlcNAc-N-Asn-[protein] = UDP + beta-D-GlcNAc-(1->2)-(beta-D-GlcNAc-(1->4))-alpha-D-Man-(1->3)-(beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->6))-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-beta-D-GlcNAc-N-Asn-[protein].

Cofactori

Kineticsi

  1. KM=0.242 mM for UDP-GlcNAc1 Publication

    Pathwayi: protein glycosylation

    This protein is involved in the pathway protein glycosylation, which is part of Protein modification.
    View all proteins of this organism that are known to be involved in the pathway protein glycosylation and in Protein modification.

    GO - Molecular functioni

    GO - Biological processi

    • N-glycan processing Source: ProtInc
    • protein N-linked glycosylation Source: Ensembl

    Keywordsi

    Molecular functionGlycosyltransferase, Transferase
    LigandMetal-binding

    Enzyme and pathway databases

    BioCyciMetaCyc:HS08564-MONOMER
    BRENDAi2.4.1.145 2681
    ReactomeiR-HSA-975577 N-Glycan antennae elongation
    UniPathwayi
    UPA00378

    Protein family/group databases

    CAZyiGT54 Glycosyltransferase Family 54

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase B (EC:2.4.1.145)
    Alternative name(s):
    N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase IVb
    Short name:
    GlcNAc-T IVb
    Short name:
    GnT-IVb
    Short name:
    N-acetylglucosaminyltransferase IVb
    UDP-N-acetylglucosamine: alpha-1,3-D-mannoside beta-1,4-N-acetylglucosaminyltransferase IVb
    Gene namesi
    Name:MGAT4B
    ORF Names:UNQ906/PRO1927
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    Proteomesi
    • UP000005640 Componenti: Chromosome 5

    Organism-specific databases

    EuPathDBiHostDB:ENSG00000161013.16
    HGNCiHGNC:7048 MGAT4B
    MIMi604561 gene
    neXtProtiNX_Q9UQ53

    Subcellular locationi

    Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

    Topology

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Topological domaini1 – 7CytoplasmicSequence analysis7
    Transmembranei8 – 28Helical; Signal-anchor for type II membrane proteinSequence analysisAdd BLAST21
    Topological domaini29 – 548LumenalSequence analysisAdd BLAST520

    Keywords - Cellular componenti

    Golgi apparatus, Membrane

    Pathology & Biotechi

    Organism-specific databases

    DisGeNETi11282
    OpenTargetsiENSG00000161013
    PharmGKBiPA30783

    Polymorphism and mutation databases

    BioMutaiMGAT4B
    DMDMi74735195

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    ChainiPRO_00002885931 – 548Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase BAdd BLAST548

    Amino acid modifications

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Glycosylationi87N-linked (GlcNAc...) asparagineSequence analysis1
    Glycosylationi103N-linked (GlcNAc...) asparagineSequence analysis1

    Keywords - PTMi

    Glycoprotein

    Proteomic databases

    EPDiQ9UQ53
    PaxDbiQ9UQ53
    PeptideAtlasiQ9UQ53
    PRIDEiQ9UQ53
    ProteomicsDBi85509
    85510 [Q9UQ53-2]
    85511 [Q9UQ53-3]

    PTM databases

    iPTMnetiQ9UQ53
    PhosphoSitePlusiQ9UQ53

    Expressioni

    Tissue specificityi

    Widely expressed. Strongly overexpressed in pancreatic cancer.1 Publication

    Gene expression databases

    BgeeiENSG00000161013 Expressed in 209 organ(s), highest expression level in mucosa of transverse colon
    CleanExiHS_MGAT4B
    ExpressionAtlasiQ9UQ53 baseline and differential
    GenevisibleiQ9UQ53 HS

    Organism-specific databases

    HPAiHPA052134

    Interactioni

    Protein-protein interaction databases

    BioGridi116438, 10 interactors
    CORUMiQ9UQ53
    IntActiQ9UQ53, 3 interactors
    STRINGi9606.ENSP00000338487

    Structurei

    3D structure databases

    ProteinModelPortaliQ9UQ53
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Coiled coil

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Coiled coili36 – 83Sequence analysisAdd BLAST48

    Sequence similaritiesi

    Belongs to the glycosyltransferase 54 family.Curated

    Keywords - Domaini

    Coiled coil, Signal-anchor, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiENOG410IEDC Eukaryota
    ENOG410XPV0 LUCA
    GeneTreeiENSGT00550000074578
    HOGENOMiHOG000015085
    HOVERGENiHBG053194
    InParanoidiQ9UQ53
    KOiK00738
    OMAiLKLWNIT
    OrthoDBiEOG091G06KB
    PhylomeDBiQ9UQ53
    TreeFamiTF324570

    Family and domain databases

    InterProiView protein in InterPro
    IPR006759 Glyco_transf_54
    PANTHERiPTHR12062 PTHR12062, 1 hit

    Sequences (3+)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

    This entry has 3 described isoforms and 9 potential isoforms that are computationally mapped.Show allAlign All

    Isoform 1 (identifier: Q9UQ53-1) [UniParc]FASTAAdd to basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide
            10         20         30         40         50
    MRLRNGTFLT LLLFCLCAFL SLSWYAALSG QKGDVVDVYQ REFLALRDRL
    60 70 80 90 100
    HAAEQESLKR SKELNLVLDE IKRAVSERQA LRDGDGNRTW GRLTEDPRLK
    110 120 130 140 150
    PWNGSHRHVL HLPTVFHHLP HLLAKESSLQ PAVRVGQGRT GVSVVMGIPS
    160 170 180 190 200
    VRREVHSYLT DTLHSLISEL SPQEKEDSVI VVLIAETDSQ YTSAVTENIK
    210 220 230 240 250
    ALFPTEIHSG LLEVISPSPH FYPDFSRLRE SFGDPKERVR WRTKQNLDYC
    260 270 280 290 300
    FLMMYAQSKG IYYVQLEDDI VAKPNYLSTM KNFALQQPSE DWMILEFSQL
    310 320 330 340 350
    GFIGKMFKSL DLSLIVEFIL MFYRDKPIDW LLDHILWVKV CNPEKDAKHC
    360 370 380 390 400
    DRQKANLRIR FKPSLFQHVG THSSLAGKIQ KLKDKDFGKQ ALRKEHVNPP
    410 420 430 440 450
    AEVSTSLKTY QHFTLEKAYL REDFFWAFTP AAGDFIRFRF FQPLRLERFF
    460 470 480 490 500
    FRSGNIEHPE DKLFNTSVEV LPFDNPQSDK EALQEGRTAT LRYPRSPDGY
    510 520 530 540
    LQIGSFYKGV AEGEVDPAFG PLEALRLSIQ TDSPVWVILS EIFLKKAD
    Length:548
    Mass (Da):63,198
    Last modified:May 1, 2000 - v1
    Checksum:i1EFF2E681D683C4D
    GO
    Isoform 2 (identifier: Q9UQ53-2) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         348-348: Missing.

    Note: No experimental confirmation available.
    Show »
    Length:547
    Mass (Da):63,070
    Checksum:i20752291F5255E6C
    GO
    Isoform 3 (identifier: Q9UQ53-3) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-32: MRLRNGTFLTLLLFCLCAFLSLSWYAALSGQK → MSRVAGTRTD...PLVTACLPPA

    Note: No experimental confirmation available.
    Show »
    Length:563
    Mass (Da):64,845
    Checksum:iBBEB51190B4F1873
    GO

    Computationally mapped potential isoform sequencesi

    There are 9 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
    EntryEntry nameProtein names
    Gene namesLengthAnnotation
    H0YC56H0YC56_HUMAN
    Alpha-1,3-mannosyl-glycoprotein 4-b...
    MGAT4B
    150Annotation score:
    E5RFL0E5RFL0_HUMAN
    Alpha-1,3-mannosyl-glycoprotein 4-b...
    MGAT4B
    157Annotation score:
    E5RFS3E5RFS3_HUMAN
    Alpha-1,3-mannosyl-glycoprotein 4-b...
    MGAT4B
    200Annotation score:
    H0YC13H0YC13_HUMAN
    Alpha-1,3-mannosyl-glycoprotein 4-b...
    MGAT4B
    322Annotation score:
    H0YB89H0YB89_HUMAN
    Alpha-1,3-mannosyl-glycoprotein 4-b...
    MGAT4B
    240Annotation score:
    H0YC79H0YC79_HUMAN
    Alpha-1,3-mannosyl-glycoprotein 4-b...
    MGAT4B
    307Annotation score:
    H0YB84H0YB84_HUMAN
    Alpha-1,3-mannosyl-glycoprotein 4-b...
    MGAT4B
    373Annotation score:
    H0YC11H0YC11_HUMAN
    Alpha-1,3-mannosyl-glycoprotein 4-b...
    MGAT4B
    429Annotation score:
    H0YB63H0YB63_HUMAN
    Alpha-1,3-mannosyl-glycoprotein 4-b...
    MGAT4B
    244Annotation score:

    Natural variant

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Natural variantiVAR_053913257Q → H. Corresponds to variant dbSNP:rs190631Ensembl.1
    Natural variantiVAR_032446491L → F1 PublicationCorresponds to variant dbSNP:rs17854722Ensembl.1

    Alternative sequence

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Alternative sequenceiVSP_0432311 – 32MRLRN…LSGQK → MSRVAGTRTDVNELLQRWTP RCVRWHTGGARRVALDRPLV TACLPPA in isoform 3. 1 PublicationAdd BLAST32
    Alternative sequenceiVSP_025716348Missing in isoform 2. 1 Publication1

    Sequence databases

    Select the link destinations:
    EMBLi
    GenBanki
    DDBJi
    Links Updated
    AB000624 mRNA Translation: BAA83464.1
    AY358984 mRNA Translation: AAQ89343.1
    AK023137 mRNA Translation: BAG51162.1
    AC008393 Genomic DNA No translation available.
    CH471165 Genomic DNA Translation: EAW53791.1
    BC009464 mRNA Translation: AAH09464.2
    BC051835 mRNA Translation: AAH51835.1
    AL162067 mRNA Translation: CAB82404.2
    CCDSiCCDS4448.1 [Q9UQ53-1]
    CCDS4449.1 [Q9UQ53-3]
    PIRiT47170
    RefSeqiNP_055090.1, NM_014275.4 [Q9UQ53-1]
    NP_463459.1, NM_054013.3 [Q9UQ53-3]
    UniGeneiHs.567419

    Genome annotation databases

    EnsembliENST00000292591; ENSP00000292591; ENSG00000161013 [Q9UQ53-1]
    ENST00000337755; ENSP00000338487; ENSG00000161013 [Q9UQ53-3]
    ENST00000638266; ENSP00000492708; ENSG00000284501 [Q9UQ53-1]
    ENST00000639538; ENSP00000491766; ENSG00000284501 [Q9UQ53-3]
    GeneIDi11282
    KEGGihsa:11282
    UCSCiuc003mkr.4 human [Q9UQ53-1]

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Similar proteinsi

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBLi
    GenBanki
    DDBJi
    Links Updated
    AB000624 mRNA Translation: BAA83464.1
    AY358984 mRNA Translation: AAQ89343.1
    AK023137 mRNA Translation: BAG51162.1
    AC008393 Genomic DNA No translation available.
    CH471165 Genomic DNA Translation: EAW53791.1
    BC009464 mRNA Translation: AAH09464.2
    BC051835 mRNA Translation: AAH51835.1
    AL162067 mRNA Translation: CAB82404.2
    CCDSiCCDS4448.1 [Q9UQ53-1]
    CCDS4449.1 [Q9UQ53-3]
    PIRiT47170
    RefSeqiNP_055090.1, NM_014275.4 [Q9UQ53-1]
    NP_463459.1, NM_054013.3 [Q9UQ53-3]
    UniGeneiHs.567419

    3D structure databases

    ProteinModelPortaliQ9UQ53
    ModBaseiSearch...
    MobiDBiSearch...

    Protein-protein interaction databases

    BioGridi116438, 10 interactors
    CORUMiQ9UQ53
    IntActiQ9UQ53, 3 interactors
    STRINGi9606.ENSP00000338487

    Protein family/group databases

    CAZyiGT54 Glycosyltransferase Family 54

    PTM databases

    iPTMnetiQ9UQ53
    PhosphoSitePlusiQ9UQ53

    Polymorphism and mutation databases

    BioMutaiMGAT4B
    DMDMi74735195

    Proteomic databases

    EPDiQ9UQ53
    PaxDbiQ9UQ53
    PeptideAtlasiQ9UQ53
    PRIDEiQ9UQ53
    ProteomicsDBi85509
    85510 [Q9UQ53-2]
    85511 [Q9UQ53-3]

    Protocols and materials databases

    DNASUi11282
    Structural Biology KnowledgebaseSearch...

    Genome annotation databases

    EnsembliENST00000292591; ENSP00000292591; ENSG00000161013 [Q9UQ53-1]
    ENST00000337755; ENSP00000338487; ENSG00000161013 [Q9UQ53-3]
    ENST00000638266; ENSP00000492708; ENSG00000284501 [Q9UQ53-1]
    ENST00000639538; ENSP00000491766; ENSG00000284501 [Q9UQ53-3]
    GeneIDi11282
    KEGGihsa:11282
    UCSCiuc003mkr.4 human [Q9UQ53-1]

    Organism-specific databases

    CTDi11282
    DisGeNETi11282
    EuPathDBiHostDB:ENSG00000161013.16
    GeneCardsiMGAT4B
    HGNCiHGNC:7048 MGAT4B
    HPAiHPA052134
    MIMi604561 gene
    neXtProtiNX_Q9UQ53
    OpenTargetsiENSG00000161013
    PharmGKBiPA30783
    GenAtlasiSearch...

    Phylogenomic databases

    eggNOGiENOG410IEDC Eukaryota
    ENOG410XPV0 LUCA
    GeneTreeiENSGT00550000074578
    HOGENOMiHOG000015085
    HOVERGENiHBG053194
    InParanoidiQ9UQ53
    KOiK00738
    OMAiLKLWNIT
    OrthoDBiEOG091G06KB
    PhylomeDBiQ9UQ53
    TreeFamiTF324570

    Enzyme and pathway databases

    UniPathwayi
    UPA00378

    BioCyciMetaCyc:HS08564-MONOMER
    BRENDAi2.4.1.145 2681
    ReactomeiR-HSA-975577 N-Glycan antennae elongation

    Miscellaneous databases

    ChiTaRSiMGAT4B human
    GeneWikiiMGAT4B
    GenomeRNAii11282
    PROiPR:Q9UQ53
    SOURCEiSearch...

    Gene expression databases

    BgeeiENSG00000161013 Expressed in 209 organ(s), highest expression level in mucosa of transverse colon
    CleanExiHS_MGAT4B
    ExpressionAtlasiQ9UQ53 baseline and differential
    GenevisibleiQ9UQ53 HS

    Family and domain databases

    InterProiView protein in InterPro
    IPR006759 Glyco_transf_54
    PANTHERiPTHR12062 PTHR12062, 1 hit
    ProtoNetiSearch...

    Entry informationi

    Entry nameiMGT4B_HUMAN
    AccessioniPrimary (citable) accession number: Q9UQ53
    Secondary accession number(s): A8MPR0
    , Q86TF1, Q96GH4, Q9NSK6
    Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 29, 2007
    Last sequence update: May 1, 2000
    Last modified: September 12, 2018
    This is version 130 of the entry and version 1 of the sequence. See complete history.
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. SIMILARITY comments
      Index of protein domains and families
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. PATHWAY comments
      Index of metabolic and biosynthesis pathways
    6. Human chromosome 5
      Human chromosome 5: entries, gene names and cross-references to MIM
    UniProt is an ELIXIR core data resource
    Main funding by: National Institutes of Health

    We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

    Do not show this banner again