Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 178 (16 Oct 2019)
Sequence version 2 (16 Jan 2004)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Regulating synaptic membrane exocytosis protein 2

Gene

RIMS2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Rab effector involved in exocytosis. May act as scaffold protein. Plays a role in dendrite formation by melanocytes (PubMed:23999003).1 Publication

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri117 – 173FYVE-typePROSITE-ProRule annotationAdd BLAST57

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processDifferentiation
LigandMetal-binding, Zinc

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Regulating synaptic membrane exocytosis protein 2
Alternative name(s):
Rab-3-interacting molecule 2
Short name:
RIM 2
Rab-3-interacting protein 3
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:RIMS2
Synonyms:KIAA0751, RAB3IP3, RIM2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 8

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:17283 RIMS2

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
606630 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9UQ26

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell junction, Cell membrane, Cell projection, Membrane, Synapse

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
9699

Open Targets

More...
OpenTargetsi
ENSG00000176406

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA38445

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q9UQ26

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
RIMS2

Domain mapping of disease mutations (DMDM)

More...
DMDMi
41019522

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001902011 – 1411Regulating synaptic membrane exocytosis protein 2Add BLAST1411

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei400PhosphoserineCombined sources1
Modified residuei689PhosphothreonineCombined sources1
Modified residuei791PhosphoserineBy similarity1
Modified residuei794PhosphoserineBy similarity1
Modified residuei1148PhosphoserineBy similarity1
Modified residuei1396PhosphoserineCombined sources1
Modified residuei1399PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9UQ26

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9UQ26

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q9UQ26

PeptideAtlas

More...
PeptideAtlasi
Q9UQ26

PRoteomics IDEntifications database

More...
PRIDEi
Q9UQ26

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
31373
85496 [Q9UQ26-6]
85497 [Q9UQ26-1]
85498 [Q9UQ26-2]
85499 [Q9UQ26-3]
85500 [Q9UQ26-4]
85501 [Q9UQ26-5]
85502 [Q9UQ26-7]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9UQ26

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9UQ26

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in melanocytes (PubMed:23999003).1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000176406 Expressed in 147 organ(s), highest expression level in forebrain

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9UQ26 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9UQ26 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB079049
HPA046538

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with RAB3A and RAB3B that have been activated by GTP-binding.

Interacts with RAB3C, RAB3D and RAB26.

Interacts with TSPOAP1 and RIMBP2.

Interacts with PPFIA3 and PPFIA4.

Interacts via its zinc finger with the first C2 domain of UNC13A.

Forms a complex consisting of UNC13A, RIMS2 and RAB3A. Heterodimer with PCLO.

Part of a ternary complex involving PCLO and EPAC2 (By similarity).

By similarity

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
NCK1P163332EBI-1756749,EBI-389883

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
115051, 4 interactors

Protein interaction database and analysis system

More...
IntActi
Q9UQ26, 6 interactors

Molecular INTeraction database

More...
MINTi
Q9UQ26

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000262231

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

11411
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9UQ26

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q9UQ26

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini26 – 185RabBDPROSITE-ProRule annotationAdd BLAST160
Domaini668 – 754PDZPROSITE-ProRule annotationAdd BLAST87
Domaini807 – 913C2 1PROSITE-ProRule annotationAdd BLAST107
Domaini1257 – 1359C2 2PROSITE-ProRule annotationAdd BLAST103

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri117 – 173FYVE-typePROSITE-ProRule annotationAdd BLAST57

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000155236

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000082403

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9UQ26

KEGG Orthology (KO)

More...
KOi
K15297

Database of Orthologous Groups

More...
OrthoDBi
109268at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9UQ26

TreeFam database of animal gene trees

More...
TreeFami
TF321703

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.60.40.150, 2 hits
3.30.40.10, 2 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR000008 C2_dom
IPR035892 C2_domain_sf
IPR041282 FYVE_2
IPR001478 PDZ
IPR041489 PDZ_6
IPR036034 PDZ_sf
IPR010911 Rab_BD
IPR039032 Rim-like
IPR030631 RIM2
IPR017455 Znf_FYVE-rel
IPR011011 Znf_FYVE_PHD
IPR013083 Znf_RING/FYVE/PHD

The PANTHER Classification System

More...
PANTHERi
PTHR12157 PTHR12157, 2 hits
PTHR12157:SF15 PTHR12157:SF15, 2 hits

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00168 C2, 2 hits
PF02318 FYVE_2, 1 hit
PF17820 PDZ_6, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00239 C2, 2 hits
SM00228 PDZ, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF50156 SSF50156, 1 hit
SSF57903 SSF57903, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50004 C2, 2 hits
PS50106 PDZ, 1 hit
PS50916 RABBD, 1 hit
PS50178 ZF_FYVE, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (8+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 8 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 8 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 6 (identifier: Q9UQ26-6) [UniParc]FASTAAdd to basket
Also known as: RIM2-alpha

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSAPVGPRGR LAPIPAASQP PLQPEMPDLS HLTEEERKII LAVMDRQKKK
60 70 80 90 100
VKEEHKPQLT QWFPFSGITE LVNNVLQPQQ KQQNEKEPQT KLHQQFEMYK
110 120 130 140 150
EQVKKMGEES QQQQEQKGDA PTCGICHKTK FADGCGHNCS YCQTKFCARC
160 170 180 190 200
GGRVSLRSNK VMWVCNLCRK QQEILTKSGA WFYNSGSNTP QQPDQKVLRG
210 220 230 240 250
LRNEEAPQEK KPKLHEQTQF QGPSGDLSVP AVEKSRSHGL TRQHSIKNGS
260 270 280 290 300
GVKHHIASDI ASDRKRSPSV SRDQNRRYDQ REEREEYSQY ATSDTAMPRS
310 320 330 340 350
PSDYADRRSQ HEPQFYEDSD HLSYRDSNRR SHRHSKEYIV DDEDVESRDE
360 370 380 390 400
YERQRREEEY QSRYRSDPNL ARYPVKPQPY EEQMRIHAEV SRARHERRHS
410 420 430 440 450
DVSLANADLE DSRISMLRMD RPSRQRSISE RRAAMENQRS YSMERTREAQ
460 470 480 490 500
GPSSYAQRTT NHSPPTPRRS PLPIDRPDLR RTDSLRKQHH LDPSSAVRKT
510 520 530 540 550
KREKMETMLR NDSLSSDQSE SVRPPPPKPH KSKKGGKMRQ ISLSSSEEEL
560 570 580 590 600
ASTPEYTSCD DVEIESESVS EKGDSQKGKR KTSEQAVLSD SNTRSERQKE
610 620 630 640 650
MMYFGGHSLE EDLEWSEPQI KDSGVDTCSS TTLNEEHSHS DKHPVTWQPS
660 670 680 690 700
KDGDRLIGRI LLNKRLKDGS VPRDSGAMLG LKVVGGKMTE SGRLCAFITK
710 720 730 740 750
VKKGSLADTV GHLRPGDEVL EWNGRLLQGA TFEEVYNIIL ESKPEPQVEL
760 770 780 790 800
VVSRPIGDIP RIPDSTHAQL ESSSSSFESQ KMDRPSISVT SPMSPGMLRD
810 820 830 840 850
VPQFLSGQLS IKLWFDKVGH QLIVTILGAK DLPSREDGRP RNPYVKIYFL
860 870 880 890 900
PDRSDKNKRR TKTVKKTLEP KWNQTFIYSP VHRREFRERM LEITLWDQAR
910 920 930 940 950
VREEESEFLG EILIELETAL LDDEPHWYKL QTHDVSSLPL PHPSPYMPRR
960 970 980 990 1000
QLHGESPTRR LQRSKRISDS EVSDYDCDDG IGVVSDYRHD GRDLQSSTLS
1010 1020 1030 1040 1050
VPEQVMSSNH CSPSGSPHRV DVIGRTRSWS PSVPPPQSRN VEQGLRGTRT
1060 1070 1080 1090 1100
MTGHYNTISR MDRHRVMDDH YSPDRDRDCE AADRQPYHRS RSTEQRPLLE
1110 1120 1130 1140 1150
RTTTRSRSTE RPDTNLMRSM PSLMTGRSAP PSPALSRSHP RTGSVQTSPS
1160 1170 1180 1190 1200
STPVAGRRGR QLPQLPPKGT LDRKAGGKKL RSTVQRSTET GLAVEMRNWM
1210 1220 1230 1240 1250
TRQASRESTD GSMNSYSSEG NLIFPGVRLA SDSQFSDFLD GLGPAQLVGR
1260 1270 1280 1290 1300
QTLATPAMGD IQVGMMDKKG QLEVEIIRAR GLVVKPGSKT LPAPYVKVYL
1310 1320 1330 1340 1350
LDNGVCIAKK KTKVARKTLE PLYQQLLSFE ESPQGKVLQI IVWGDYGRMD
1360 1370 1380 1390 1400
HKSFMGVAQI LLDELELSNM VIGWFKLFPP SSLVDPTLAP LTRRASQSSL
1410
ESSTGPSYSR S
Note: No experimental confirmation available.
Length:1,411
Mass (Da):160,403
Last modified:January 16, 2004 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i9D4E83F4CBE4A864
GO
Isoform 1 (identifier: Q9UQ26-1) [UniParc]FASTAAdd to basket
Also known as: RIM2-beta

The sequence of this isoform differs from the canonical sequence as follows:
     1-223: Missing.
     224-263: SGDLSVPAVE...HHIASDIASD → MQFETLRQVC...ELFGQTLNNA

Show »
Length:1,188
Mass (Da):135,250
Checksum:iDD65DB32288055AF
GO
Isoform 2 (identifier: Q9UQ26-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1038-1038: S → R
     1039-1411: Missing.

Note: May be due to an intron retention. No experimental confirmation available.
Show »
Length:1,038
Mass (Da):119,057
Checksum:i6EFF188912E7C9B7
GO
Isoform 3 (identifier: Q9UQ26-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-223: Missing.
     224-263: SGDLSVPAVE...HHIASDIASD → MQFETLRQVC...ELFGQTLNNA
     575-642: SQKGKRKTSE...LNEEHSHSDK → MDYNWLDHTSWHSSEASPMSL
     1076-1076: D → DSHFLTLPRSRYSQTIDHHHRDG

Note: No experimental confirmation available.
Show »
Length:1,163
Mass (Da):132,670
Checksum:i30E1EB86C76B0998
GO
Isoform 4 (identifier: Q9UQ26-4) [UniParc]FASTAAdd to basket
Also known as: RimL3a

The sequence of this isoform differs from the canonical sequence as follows:
     774-801: SSSFESQKMDRPSISVTSPMSPGMLRDV → KFYLCWKKTLFIIAFIRDQMKYLTSNVK
     802-1411: Missing.

Note: May be due to an intron retention. No experimental confirmation available.
Show »
Length:801
Mass (Da):91,941
Checksum:iAC3B759DF8D4640F
GO
Isoform 5 (identifier: Q9UQ26-5) [UniParc]FASTAAdd to basket
Also known as: RimL3c

The sequence of this isoform differs from the canonical sequence as follows:
     811-824: IKLWFDKVGHQLIV → VCSHYVYSSFWNIK
     825-1411: Missing.

Note: May be due to an intron retention. No experimental confirmation available.
Show »
Length:824
Mass (Da):94,172
Checksum:i8C1E96D4AA918687
GO
Isoform 7 (identifier: Q9UQ26-7) [UniParc]FASTAAdd to basket
Also known as: RIM2-gamma

The sequence of this isoform differs from the canonical sequence as follows:
     1-1126: Missing.
     1127-1174: RSAPPSPALS...LPPKGTLDRK → MGRQGLGGAS...MNSLEEEEGE

Show »
Length:285
Mass (Da):30,972
Checksum:i6E39DC2A4F246F79
GO
Isoform 8 (identifier: Q9UQ26-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     50-90: KVKEEHKPQLTQWFPFSGITELVNNVLQPQQKQQNEKEPQT → EEEKEQSVLK
     575-642: SQKGKRKTSE...LNEEHSHSDK → MDYNWLDHTSWHSSEASPMSL
     810-810: S → SSQSLSRRTTPFVPRVQ

Note: No experimental confirmation available.
Show »
Length:1,349
Mass (Da):153,363
Checksum:iD385AB7B1AB598D6
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0J9YWD4A0A0J9YWD4_HUMAN
Regulating synaptic membrane exocyt...
RIMS2
1,121Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RA03D6RA03_HUMAN
Regulating synaptic membrane exocyt...
RIMS2
1,367Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8W6W8F8W6W8_HUMAN
Regulating synaptic membrane exocyt...
RIMS2
1,253Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RDY0D6RDY0_HUMAN
Regulating synaptic membrane exocyt...
RIMS2
665Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E5RI36E5RI36_HUMAN
Regulating synaptic membrane exocyt...
RIMS2
258Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0J9YXG4A0A0J9YXG4_HUMAN
Regulating synaptic membrane exocyt...
RIMS2
370Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAA34471 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti309S → F in AAH43144 (PubMed:15489334).Curated1
Sequence conflicti518Q → R in AAH43144 (PubMed:15489334).Curated1
Sequence conflicti947M → V in BAG54403 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0408641 – 1126Missing in isoform 7. CuratedAdd BLAST1126
Alternative sequenceiVSP_0408651 – 223Missing in isoform 1 and isoform 3. 2 PublicationsAdd BLAST223
Alternative sequenceiVSP_04466150 – 90KVKEE…KEPQT → EEEKEQSVLK in isoform 8. 1 PublicationAdd BLAST41
Alternative sequenceiVSP_040866224 – 263SGDLS…DIASD → MQFETLRQVCNSVLSHFHGV FSSPPNILQNELFGQTLNNA in isoform 1 and isoform 3. 2 PublicationsAdd BLAST40
Alternative sequenceiVSP_040867575 – 642SQKGK…SHSDK → MDYNWLDHTSWHSSEASPMS L in isoform 3 and isoform 8. 2 PublicationsAdd BLAST68
Alternative sequenceiVSP_040868774 – 801SSSFE…MLRDV → KFYLCWKKTLFIIAFIRDQM KYLTSNVK in isoform 4. 1 PublicationAdd BLAST28
Alternative sequenceiVSP_040871802 – 1411Missing in isoform 4. 1 PublicationAdd BLAST610
Alternative sequenceiVSP_044662810S → SSQSLSRRTTPFVPRVQ in isoform 8. 1 Publication1
Alternative sequenceiVSP_040869811 – 824IKLWF…HQLIV → VCSHYVYSSFWNIK in isoform 5. 1 PublicationAdd BLAST14
Alternative sequenceiVSP_040870825 – 1411Missing in isoform 5. 1 PublicationAdd BLAST587
Alternative sequenceiVSP_0408721038S → R in isoform 2. 1 Publication1
Alternative sequenceiVSP_0408731039 – 1411Missing in isoform 2. 1 PublicationAdd BLAST373
Alternative sequenceiVSP_0408741076D → DSHFLTLPRSRYSQTIDHHH RDG in isoform 3. 1 Publication1
Alternative sequenceiVSP_0408751127 – 1174RSAPP…TLDRK → MGRQGLGGASAAGRSMQRSQ SRSSLSASFEALAGYFPCMN SLEEEEGE in isoform 7. CuratedAdd BLAST48

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB018294 mRNA Translation: BAA34471.2 Different initiation.
AF007156 mRNA Translation: AAC19157.1
AK126939 mRNA Translation: BAG54403.1
AC007751 Genomic DNA No translation available.
AC012213 Genomic DNA No translation available.
AC090448 Genomic DNA No translation available.
AC090686 Genomic DNA No translation available.
AC107933 Genomic DNA No translation available.
AP001572 Genomic DNA No translation available.
AP002849 Genomic DNA No translation available.
BC043144 mRNA Translation: AAH43144.1
AY057119 mRNA Translation: AAL23679.1
AY057121 mRNA Translation: AAL23681.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS43761.1 [Q9UQ26-3]
CCDS55269.1 [Q9UQ26-8]
CCDS64948.1 [Q9UQ26-1]
CCDS64949.1 [Q9UQ26-7]

NCBI Reference Sequences

More...
RefSeqi
NP_001093587.1, NM_001100117.2 [Q9UQ26-8]
NP_001269810.1, NM_001282881.1 [Q9UQ26-1]
NP_001269811.1, NM_001282882.1 [Q9UQ26-7]
NP_055492.3, NM_014677.4 [Q9UQ26-3]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000262231; ENSP00000262231; ENSG00000176406 [Q9UQ26-1]
ENST00000339750; ENSP00000342051; ENSG00000176406 [Q9UQ26-7]
ENST00000504942; ENSP00000427018; ENSG00000176406 [Q9UQ26-8]
ENST00000507740; ENSP00000423559; ENSG00000176406 [Q9UQ26-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
9699

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:9699

UCSC genome browser

More...
UCSCi
uc003ylq.4 human [Q9UQ26-6]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB018294 mRNA Translation: BAA34471.2 Different initiation.
AF007156 mRNA Translation: AAC19157.1
AK126939 mRNA Translation: BAG54403.1
AC007751 Genomic DNA No translation available.
AC012213 Genomic DNA No translation available.
AC090448 Genomic DNA No translation available.
AC090686 Genomic DNA No translation available.
AC107933 Genomic DNA No translation available.
AP001572 Genomic DNA No translation available.
AP002849 Genomic DNA No translation available.
BC043144 mRNA Translation: AAH43144.1
AY057119 mRNA Translation: AAL23679.1
AY057121 mRNA Translation: AAL23681.1
CCDSiCCDS43761.1 [Q9UQ26-3]
CCDS55269.1 [Q9UQ26-8]
CCDS64948.1 [Q9UQ26-1]
CCDS64949.1 [Q9UQ26-7]
RefSeqiNP_001093587.1, NM_001100117.2 [Q9UQ26-8]
NP_001269810.1, NM_001282881.1 [Q9UQ26-1]
NP_001269811.1, NM_001282882.1 [Q9UQ26-7]
NP_055492.3, NM_014677.4 [Q9UQ26-3]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1V27NMR-A807-934[»]
1WFGNMR-A637-754[»]
SMRiQ9UQ26
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGridi115051, 4 interactors
IntActiQ9UQ26, 6 interactors
MINTiQ9UQ26
STRINGi9606.ENSP00000262231

PTM databases

iPTMnetiQ9UQ26
PhosphoSitePlusiQ9UQ26

Polymorphism and mutation databases

BioMutaiRIMS2
DMDMi41019522

Proteomic databases

EPDiQ9UQ26
jPOSTiQ9UQ26
MassIVEiQ9UQ26
PeptideAtlasiQ9UQ26
PRIDEiQ9UQ26
ProteomicsDBi31373
85496 [Q9UQ26-6]
85497 [Q9UQ26-1]
85498 [Q9UQ26-2]
85499 [Q9UQ26-3]
85500 [Q9UQ26-4]
85501 [Q9UQ26-5]
85502 [Q9UQ26-7]

Genome annotation databases

EnsembliENST00000262231; ENSP00000262231; ENSG00000176406 [Q9UQ26-1]
ENST00000339750; ENSP00000342051; ENSG00000176406 [Q9UQ26-7]
ENST00000504942; ENSP00000427018; ENSG00000176406 [Q9UQ26-8]
ENST00000507740; ENSP00000423559; ENSG00000176406 [Q9UQ26-3]
GeneIDi9699
KEGGihsa:9699
UCSCiuc003ylq.4 human [Q9UQ26-6]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
9699
DisGeNETi9699

GeneCards: human genes, protein and diseases

More...
GeneCardsi
RIMS2
HGNCiHGNC:17283 RIMS2
HPAiCAB079049
HPA046538
MIMi606630 gene
neXtProtiNX_Q9UQ26
OpenTargetsiENSG00000176406
PharmGKBiPA38445

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

GeneTreeiENSGT00940000155236
HOGENOMiHOG000082403
InParanoidiQ9UQ26
KOiK15297
OrthoDBi109268at2759
PhylomeDBiQ9UQ26
TreeFamiTF321703

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
RIMS2 human
EvolutionaryTraceiQ9UQ26

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
RIMS2

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
9699
PharosiQ9UQ26

Protein Ontology

More...
PROi
PR:Q9UQ26

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000176406 Expressed in 147 organ(s), highest expression level in forebrain
ExpressionAtlasiQ9UQ26 baseline and differential
GenevisibleiQ9UQ26 HS

Family and domain databases

Gene3Di2.60.40.150, 2 hits
3.30.40.10, 2 hits
InterProiView protein in InterPro
IPR000008 C2_dom
IPR035892 C2_domain_sf
IPR041282 FYVE_2
IPR001478 PDZ
IPR041489 PDZ_6
IPR036034 PDZ_sf
IPR010911 Rab_BD
IPR039032 Rim-like
IPR030631 RIM2
IPR017455 Znf_FYVE-rel
IPR011011 Znf_FYVE_PHD
IPR013083 Znf_RING/FYVE/PHD
PANTHERiPTHR12157 PTHR12157, 2 hits
PTHR12157:SF15 PTHR12157:SF15, 2 hits
PfamiView protein in Pfam
PF00168 C2, 2 hits
PF02318 FYVE_2, 1 hit
PF17820 PDZ_6, 1 hit
SMARTiView protein in SMART
SM00239 C2, 2 hits
SM00228 PDZ, 1 hit
SUPFAMiSSF50156 SSF50156, 1 hit
SSF57903 SSF57903, 1 hit
PROSITEiView protein in PROSITE
PS50004 C2, 2 hits
PS50106 PDZ, 1 hit
PS50916 RABBD, 1 hit
PS50178 ZF_FYVE, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiRIMS2_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9UQ26
Secondary accession number(s): B3KX91
, F8WD47, O43413, Q86XL9, Q8IWV9, Q8IWW1
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 29, 2003
Last sequence update: January 16, 2004
Last modified: October 16, 2019
This is version 178 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. Human chromosome 8
    Human chromosome 8: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again