Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Histone lysine demethylase PHF8

Gene

PHF8

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Histone lysine demethylase with selectivity for the di- and monomethyl states that plays a key role cell cycle progression, rDNA transcription and brain development. Demethylates mono- and dimethylated histone H3 'Lys-9' residue (H3K9Me1 and H3K9Me2), dimethylated H3 'Lys-27' (H3K27Me2) and monomethylated histone H4 'Lys-20' residue (H4K20Me1). Acts as a transcription activator as H3K9Me1, H3K9Me2, H3K27Me2 and H4K20Me1 are epigenetic repressive marks. Involved in cell cycle progression by being required to control G1-S transition. Acts as a coactivator of rDNA transcription, by activating polymerase I (pol I) mediated transcription of rRNA genes. Required for brain development, probably by regulating expression of neuron-specific genes. Only has activity toward H4K20Me1 when nucleosome is used as a substrate and when not histone octamer is used as substrate. May also have weak activity toward dimethylated H3 'Lys-36' (H3K36Me2), however, the relevance of this result remains unsure in vivo. Specifically binds trimethylated 'Lys-4' of histone H3 (H3K4me3), affecting histone demethylase specificity: has weak activity toward H3K9Me2 in absence of H3K4me3, while it has high activity toward H3K9me2 when binding H3K4me3.10 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the ‘Function’ section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Fe2+2 PublicationsNote: Binds 1 Fe2+ ion per subunit.2 Publications

<p>This subsection of the ‘Function’ section describes biophysical and chemical properties, such as maximal absorption, kinetic parameters, pH dependence, redox potentials and temperature dependence.<p><a href='/help/biophysicochemical_properties' target='_top'>More...</a></p>Kineticsi

  1. KM=134 µM for histone H3 H3K9Me21 Publication
  2. KM=8 µM for histone H3 H3K4me3 and H3K9Me21 Publication

    Sites

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘Function’ section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei280Substrate1
    <p>This subsection of the ‘Function’ section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the ‘Description’ field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi283Iron; catalyticPROSITE-ProRule annotation2 Publications1
    Metal bindingi285Iron; catalyticPROSITE-ProRule annotation2 Publications1
    Binding sitei300Substrate1
    Metal bindingi355Iron; catalyticPROSITE-ProRule annotation2 Publications1

    Regions

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘Function’ section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri41 – 92PHD-typePROSITE-ProRule annotationAdd BLAST52

    <p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

    GO - Biological processi

    <p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

    Molecular functionActivator, Chromatin regulator, Dioxygenase, Oxidoreductase
    Biological processCell cycle, Transcription, Transcription regulation
    LigandIron, Metal-binding, Zinc

    Enzyme and pathway databases

    Reactome - a knowledgebase of biological pathways and processes

    More...
    Reactomei
    R-HSA-2299718 Condensation of Prophase Chromosomes
    R-HSA-3214842 HDMs demethylate histones

    <p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
    Recommended name:
    Histone lysine demethylase PHF8 (EC:1.14.11.272 Publications)
    Alternative name(s):
    PHD finger protein 8
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
    Name:PHF8
    Synonyms:KIAA1111, ZNF422
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
    • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome X

    Organism-specific databases

    Eukaryotic Pathogen Database Resources

    More...
    EuPathDBi
    HostDB:ENSG00000172943.18

    Human Gene Nomenclature Database

    More...
    HGNCi
    HGNC:20672 PHF8

    Online Mendelian Inheritance in Man (OMIM)

    More...
    MIMi
    300560 gene

    neXtProt; the human protein knowledge platform

    More...
    neXtProti
    NX_Q9UPP1

    <p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

    Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

    Keywords - Cellular componenti

    Nucleus

    <p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

    <p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

    Mental retardation, X-linked, syndromic, Siderius type (MRXSSD)9 Publications
    The disease is caused by mutations affecting the gene represented in this entry.
    Disease descriptionA syndrome characterized by mild to borderline mental retardation with or without cleft lip/cleft palate.
    See also OMIM:300263
    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_062250315F → S in MRXSSD; abolishes histone methyltransferase activity. 8 PublicationsCorresponds to variant dbSNP:rs121918524Ensembl.1

    Mutagenesis

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi43Y → A: Abolishes binding to H3K4me3; when associated with A-50. 2 Publications1
    Mutagenesisi50Y → A: Abolishes binding to H3K4me3; when associated with A-43. Abolishes binding to H3K4me3; when associated with A-65. 1 Publication1
    Mutagenesisi65W → A: Abolishes binding to H3K4me3; when associated with A-50. 1 Publication1
    Mutagenesisi69S → A: Impairs phosphorylation by CDK1 and dissociation from chromatin when cells enter mitosis; when associated with A-120. 1 Publication1
    Mutagenesisi120S → A: Impairs phosphorylation by CDK1 and dissociation from chromatin when cells enter mitosis; when associated with A-69. 1 Publication1
    Mutagenesisi283 – 285HID → AAA: Abolishes histone methyltransferase activity. 1 Publication3
    Mutagenesisi283H → A: Abolishes histone methyltransferase activity. 3 Publications1

    Keywords - Diseasei

    Disease mutation, Mental retardation

    Organism-specific databases

    DisGeNET

    More...
    DisGeNETi
    23133

    MalaCards human disease database

    More...
    MalaCardsi
    PHF8
    MIMi300263 phenotype

    Open Targets

    More...
    OpenTargetsi
    ENSG00000172943

    Orphanet; a database dedicated to information on rare diseases and orphan drugs

    More...
    Orphaneti
    85287 X-linked intellectual disability, Siderius type

    The Pharmacogenetics and Pharmacogenomics Knowledge Base

    More...
    PharmGKBi
    PA134889361

    Chemistry databases

    ChEMBL database of bioactive drug-like small molecules

    More...
    ChEMBLi
    CHEMBL1938212

    IUPHAR/BPS Guide to PHARMACOLOGY

    More...
    GuidetoPHARMACOLOGYi
    2698

    Polymorphism and mutation databases

    BioMuta curated single-nucleotide variation and disease association database

    More...
    BioMutai
    PHF8

    Domain mapping of disease mutations (DMDM)

    More...
    DMDMi
    73620986

    <p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

    Molecule processing

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000592951 – 1060Histone lysine demethylase PHF8Add BLAST1060

    Amino acid modifications

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei69Phosphoserine; by CDK11 Publication1
    Modified residuei120Phosphoserine; by CDK1Combined sources1 Publication1
    Modified residuei651PhosphoserineCombined sources1
    Modified residuei704PhosphotyrosineBy similarity1
    Modified residuei705PhosphothreonineCombined sources1
    Modified residuei706PhosphothreonineCombined sources1
    Modified residuei722PhosphoserineCombined sources1
    Modified residuei804PhosphoserineCombined sources1
    Modified residuei826PhosphoserineBy similarity1
    Modified residuei834PhosphoserineBy similarity1
    Modified residuei854PhosphoserineCombined sources1
    Modified residuei857PhosphoserineCombined sources1
    Modified residuei880PhosphoserineCombined sources1

    <p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

    Phosphorylation at Ser-69 and Ser-120 are required for dissociation from chromatin and accumulation of H4K20Me1 levels during prophase.1 Publication

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    Encyclopedia of Proteome Dynamics

    More...
    EPDi
    Q9UPP1

    PaxDb, a database of protein abundance averages across all three domains of life

    More...
    PaxDbi
    Q9UPP1

    PeptideAtlas

    More...
    PeptideAtlasi
    Q9UPP1

    PRoteomics IDEntifications database

    More...
    PRIDEi
    Q9UPP1

    ProteomicsDB human proteome resource

    More...
    ProteomicsDBi
    85394
    85395 [Q9UPP1-2]
    85396 [Q9UPP1-3]
    85397 [Q9UPP1-4]

    PTM databases

    iPTMnet integrated resource for PTMs in systems biology context

    More...
    iPTMneti
    Q9UPP1

    Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

    More...
    PhosphoSitePlusi
    Q9UPP1

    SwissPalm database of S-palmitoylation events

    More...
    SwissPalmi
    Q9UPP1

    <p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

    Gene expression databases

    Bgee dataBase for Gene Expression Evolution

    More...
    Bgeei
    ENSG00000172943 Expressed in 196 organ(s), highest expression level in testis

    CleanEx database of gene expression profiles

    More...
    CleanExi
    HS_PHF8

    ExpressionAtlas, Differential and Baseline Expression

    More...
    ExpressionAtlasi
    Q9UPP1 baseline and differential

    Genevisible search portal to normalized and curated expression data from Genevestigator

    More...
    Genevisiblei
    Q9UPP1 HS

    Organism-specific databases

    Human Protein Atlas

    More...
    HPAi
    HPA038779
    HPA062015

    <p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

    <p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

    Interacts with POLR1B, UBTF, SETD1A, HCFC1, E2F1 and ZNF711.5 Publications

    <p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

    GO - Molecular functioni

    Protein-protein interaction databases

    The Biological General Repository for Interaction Datasets (BioGrid)

    More...
    BioGridi
    116751, 83 interactors

    Database of interacting proteins

    More...
    DIPi
    DIP-38913N

    Protein interaction database and analysis system

    More...
    IntActi
    Q9UPP1, 37 interactors

    Molecular INTeraction database

    More...
    MINTi
    Q9UPP1

    STRING: functional protein association networks

    More...
    STRINGi
    9606.ENSP00000350676

    Chemistry databases

    BindingDB database of measured binding affinities

    More...
    BindingDBi
    Q9UPP1

    <p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

    Secondary structure

    11060
    Legend: HelixTurnBeta strandPDB Structure known for this area
    Show more details

    3D structure databases

    Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

    More...
    ProteinModelPortali
    Q9UPP1

    SWISS-MODEL Repository - a database of annotated 3D protein structure models

    More...
    SMRi
    Q9UPP1

    Database of comparative protein structure models

    More...
    ModBasei
    Search...

    MobiDB: a database of protein disorder and mobility annotations

    More...
    MobiDBi
    Search...

    Miscellaneous databases

    Relative evolutionary importance of amino acids within a protein sequence

    More...
    EvolutionaryTracei
    Q9UPP1

    <p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini231 – 387JmjCPROSITE-ProRule annotationAdd BLAST157

    Region

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni101 – 115LinkerAdd BLAST15

    Compositional bias

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi769 – 807Ser-richAdd BLAST39

    <p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

    The PHD-type zinc finger mediates the binding to H3K4me3. Binding to H3K4me3 promotes its access to H3K9me2.
    The linker region is a critical determinant of demethylase specificity. It enables the active site of JmjC to reach the target H3K9me2 when the PHD-type zinc finger binds to H3K4me3.

    <p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

    Zinc finger

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Zinc fingeri41 – 92PHD-typePROSITE-ProRule annotationAdd BLAST52

    Keywords - Domaini

    Zinc-finger

    Phylogenomic databases

    evolutionary genealogy of genes: Non-supervised Orthologous Groups

    More...
    eggNOGi
    KOG1633 Eukaryota
    ENOG410XQXU LUCA

    Ensembl GeneTree

    More...
    GeneTreei
    ENSGT00940000157847

    The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

    More...
    HOGENOMi
    HOG000231232

    The HOVERGEN Database of Homologous Vertebrate Genes

    More...
    HOVERGENi
    HBG045631

    InParanoid: Eukaryotic Ortholog Groups

    More...
    InParanoidi
    Q9UPP1

    KEGG Orthology (KO)

    More...
    KOi
    K19415

    Identification of Orthologs from Complete Genome Data

    More...
    OMAi
    LGTCFKD

    Database of Orthologous Groups

    More...
    OrthoDBi
    EOG091G09DB

    Database for complete collections of gene phylogenies

    More...
    PhylomeDBi
    Q9UPP1

    TreeFam database of animal gene trees

    More...
    TreeFami
    TF106480

    Family and domain databases

    Integrated resource of protein families, domains and functional sites

    More...
    InterProi
    View protein in InterPro
    IPR003347 JmjC_dom
    IPR019786 Zinc_finger_PHD-type_CS
    IPR011011 Znf_FYVE_PHD
    IPR001965 Znf_PHD
    IPR019787 Znf_PHD-finger

    Pfam protein domain database

    More...
    Pfami
    View protein in Pfam
    PF02373 JmjC, 1 hit
    PF00628 PHD, 1 hit

    Simple Modular Architecture Research Tool; a protein domain database

    More...
    SMARTi
    View protein in SMART
    SM00558 JmjC, 1 hit
    SM00249 PHD, 1 hit

    Superfamily database of structural and functional annotation

    More...
    SUPFAMi
    SSF57903 SSF57903, 1 hit

    PROSITE; a protein domain and family database

    More...
    PROSITEi
    View protein in PROSITE
    PS51184 JMJC, 1 hit
    PS01359 ZF_PHD_1, 1 hit
    PS50016 ZF_PHD_2, 1 hit

    <p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

    <p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

    This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

    This entry has 5 described isoforms and 9 potential isoforms that are computationally mapped.Show allAlign All

    Isoform 1 (identifier: Q9UPP1-1) [UniParc]FASTAAdd to basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide
            10         20         30         40         50
    MNRSRAIVQR GRVLPPPAPL DTTNLAGRRT LQGRAKMASV PVYCLCRLPY
    60 70 80 90 100
    DVTRFMIECD MCQDWFHGSC VGVEEEKAAD IDLYHCPNCE VLHGPSIMKK
    110 120 130 140 150
    RRGSSKGHDT HKGKPVKTGS PTFVRELRSR TFDSSDEVIL KPTGNQLTVE
    160 170 180 190 200
    FLEENSFSVP ILVLKKDGLG MTLPSPSFTV RDVEHYVGSD KEIDVIDVTR
    210 220 230 240 250
    QADCKMKLGD FVKYYYSGKR EKVLNVISLE FSDTRLSNLV ETPKIVRKLS
    260 270 280 290 300
    WVENLWPEEC VFERPNVQKY CLMSVRDSYT DFHIDFGGTS VWYHVLKGEK
    310 320 330 340 350
    IFYLIRPTNA NLTLFECWSS SSNQNEMFFG DQVDKCYKCS VKQGQTLFIP
    360 370 380 390 400
    TGWIHAVLTP VDCLAFGGNF LHSLNIEMQL KAYEIEKRLS TADLFRFPNF
    410 420 430 440 450
    ETICWYVGKH ILDIFRGLRE NRRHPASYLV HGGKALNLAF RAWTRKEALP
    460 470 480 490 500
    DHEDEIPETV RTVQLIKDLA REIRLVEDIF QQNVGKTSNI FGLQRIFPAG
    510 520 530 540 550
    SIPLTRPAHS TSVSMSRLSL PSKNGSKKKG LKPKELFKKA ERKGKESSAL
    560 570 580 590 600
    GPAGQLSYNL MDTYSHQALK TGSFQKAKFN ITGACLNDSD DDSPDLDLDG
    610 620 630 640 650
    NESPLALLMS NGSTKRVKSL SKSRRTKIAK KVDKARLMAE QVMEDEFDLD
    660 670 680 690 700
    SDDELQIDER LGKEKATLII RPKFPRKLPR AKPCSDPNRV REPGEVEFDI
    710 720 730 740 750
    EEDYTTDEDM VEGVEGKLGN GSGAGGILDL LKASRQVGGP DYAALTEAPA
    760 770 780 790 800
    SPSTQEAIQG MLCMANLQSS SSSPATSSLQ AWWTGGQDRS SGSSSSGLGT
    810 820 830 840 850
    VSNSPASQRT PGKRPIKRPA YWRTESEEEE ENASLDEQDS LGACFKDAEY
    860 870 880 890 900
    IYPSLESDDD DPALKSRPKK KKNSDDAPWS PKARVTPTLP KQDRPVREGT
    910 920 930 940 950
    RVASIETGLA AAAAKLAQQE LQKAQKKKYI KKKPLLKEVE QPRPQDSNLS
    960 970 980 990 1000
    LTVPAPTVAA TPQLVTSSSP LPPPEPKQEA LSGSLADHEY TARPNAFGMA
    1010 1020 1030 1040 1050
    QANRSTTPMA PGVFLTQRRP SVGSQSNQAG QGKRPKKGLA TAKQRLGRIL
    1060
    KIHRNGKLLL
    Length:1,060
    Mass (Da):117,864
    Last modified:August 16, 2005 - v3
    <p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i04C83D7C5E9E56B8
    GO
    Isoform 2 (identifier: Q9UPP1-2) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-36: Missing.

    Show »
    Length:1,024
    Mass (Da):113,913
    Checksum:i75773C0918578FB0
    GO
    Isoform 3 (identifier: Q9UPP1-3) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         478-578: Missing.

    Note: No experimental confirmation available.
    Show »
    Length:959
    Mass (Da):106,902
    Checksum:iF54BE8A814BF1701
    GO
    Isoform 4 (identifier: Q9UPP1-4) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-36: Missing.
         478-578: Missing.
         1060-1060: L → LRQVIVQAECRQAIHEPKLKRRDAHP

    Note: No experimental confirmation available.
    Show »
    Length:948
    Mass (Da):105,913
    Checksum:iF32740CB7A2CE3F6
    GO
    Isoform 5 (identifier: Q9UPP1-5) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-36: Missing.
         717-746: KLGNGSGAGGILDLLKASRQVGGPDYAALT → YQTATPAPAQGAS
         920-931: ELQKAQKKKYIK → VKKMKLSLTDSG
         932-1060: Missing.

    Show »
    Length:878
    Mass (Da):98,290
    Checksum:i690CE764C0C28D28
    GO

    <p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

    There are 9 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
    EntryEntry nameProtein names
    Gene namesLengthAnnotation
    H0Y589H0Y589_HUMAN
    Histone lysine demethylase PHF8
    PHF8
    659Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    H0Y3N9H0Y3N9_HUMAN
    Histone lysine demethylase PHF8
    PHF8
    953Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    B0QZZ2B0QZZ2_HUMAN
    Histone lysine demethylase PHF8
    PHF8
    115Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    B0QZZ3B0QZZ3_HUMAN
    Histone lysine demethylase PHF8
    PHF8
    126Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    Q5JPR8Q5JPR8_HUMAN
    Histone lysine demethylase PHF8
    PHF8
    114Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    B0QZE1B0QZE1_HUMAN
    Histone lysine demethylase PHF8
    PHF8
    148Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    B0QZZ4B0QZZ4_HUMAN
    Histone lysine demethylase PHF8
    PHF8
    97Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    H7BZB7H7BZB7_HUMAN
    Histone lysine demethylase PHF8
    PHF8
    174Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    H0Y7M8H0Y7M8_HUMAN
    Histone lysine demethylase PHF8
    PHF8
    134Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

    <p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

    The sequence BAA83063 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
    The sequence BAB13877 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
    The sequence CAI45929 differs from that shown. Reason: Erroneous termination at position 419. Translated as Arg.Curated

    Experimental Info

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti232S → P in BAB13877 (PubMed:12168954).Curated1

    Natural variant

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Natural variantiVAR_062250315F → S in MRXSSD; abolishes histone methyltransferase activity. 8 PublicationsCorresponds to variant dbSNP:rs121918524Ensembl.1
    Natural variantiVAR_076254969Missing Found in patients with autism spectrum disorders; unknown pathological significance. 1 Publication1

    Alternative sequence

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0149641 – 36Missing in isoform 2, isoform 4 and isoform 5. 3 PublicationsAdd BLAST36
    Alternative sequenceiVSP_014965478 – 578Missing in isoform 3 and isoform 4. 1 PublicationAdd BLAST101
    Alternative sequenceiVSP_054019717 – 746KLGNG…YAALT → YQTATPAPAQGAS in isoform 5. 1 PublicationAdd BLAST30
    Alternative sequenceiVSP_054020920 – 931ELQKA…KKYIK → VKKMKLSLTDSG in isoform 5. 1 PublicationAdd BLAST12
    Alternative sequenceiVSP_054021932 – 1060Missing in isoform 5. 1 PublicationAdd BLAST129
    Alternative sequenceiVSP_0436401060L → LRQVIVQAECRQAIHEPKLK RRDAHP in isoform 4. 1 Publication1

    Sequence databases

    Select the link destinations:

    EMBL nucleotide sequence database

    More...
    EMBLi

    GenBank nucleotide sequence database

    More...
    GenBanki

    DNA Data Bank of Japan; a nucleotide sequence database

    More...
    DDBJi
    Links Updated
    AB029034 mRNA Translation: BAA83063.1 Different initiation.
    CR933612 mRNA Translation: CAI45929.1 Sequence problems.
    AK021696 mRNA Translation: BAB13877.1 Different initiation.
    AK022788 mRNA Translation: BAG51116.1
    AK304272 mRNA Translation: BAH14147.1
    AL589872 Genomic DNA No translation available.
    AL732374 Genomic DNA No translation available.
    Z98051 Genomic DNA No translation available.
    BC042108 mRNA No translation available.
    BC053861 mRNA Translation: AAH53861.1

    The Consensus CDS (CCDS) project

    More...
    CCDSi
    CCDS14355.1 [Q9UPP1-2]
    CCDS55418.1 [Q9UPP1-4]
    CCDS55419.1 [Q9UPP1-5]
    CCDS55420.1 [Q9UPP1-1]

    NCBI Reference Sequences

    More...
    RefSeqi
    NP_001171825.1, NM_001184896.1 [Q9UPP1-1]
    NP_001171826.1, NM_001184897.1 [Q9UPP1-4]
    NP_055922.1, NM_015107.2 [Q9UPP1-2]
    XP_016884851.1, XM_017029362.1 [Q9UPP1-2]

    UniGene gene-oriented nucleotide sequence clusters

    More...
    UniGenei
    Hs.133352

    Genome annotation databases

    Ensembl eukaryotic genome annotation project

    More...
    Ensembli
    ENST00000322659; ENSP00000319473; ENSG00000172943 [Q9UPP1-5]
    ENST00000338154; ENSP00000338868; ENSG00000172943 [Q9UPP1-2]
    ENST00000338946; ENSP00000340051; ENSG00000172943 [Q9UPP1-4]
    ENST00000357988; ENSP00000350676; ENSG00000172943 [Q9UPP1-1]

    Database of genes from NCBI RefSeq genomes

    More...
    GeneIDi
    23133

    KEGG: Kyoto Encyclopedia of Genes and Genomes

    More...
    KEGGi
    hsa:23133

    UCSC genome browser

    More...
    UCSCi
    uc004dst.4 human [Q9UPP1-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    <p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

    <p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBLi
    GenBanki
    DDBJi
    Links Updated
    AB029034 mRNA Translation: BAA83063.1 Different initiation.
    CR933612 mRNA Translation: CAI45929.1 Sequence problems.
    AK021696 mRNA Translation: BAB13877.1 Different initiation.
    AK022788 mRNA Translation: BAG51116.1
    AK304272 mRNA Translation: BAH14147.1
    AL589872 Genomic DNA No translation available.
    AL732374 Genomic DNA No translation available.
    Z98051 Genomic DNA No translation available.
    BC042108 mRNA No translation available.
    BC053861 mRNA Translation: AAH53861.1
    CCDSiCCDS14355.1 [Q9UPP1-2]
    CCDS55418.1 [Q9UPP1-4]
    CCDS55419.1 [Q9UPP1-5]
    CCDS55420.1 [Q9UPP1-1]
    RefSeqiNP_001171825.1, NM_001184896.1 [Q9UPP1-1]
    NP_001171826.1, NM_001184897.1 [Q9UPP1-4]
    NP_055922.1, NM_015107.2 [Q9UPP1-2]
    XP_016884851.1, XM_017029362.1 [Q9UPP1-2]
    UniGeneiHs.133352

    3D structure databases

    Select the link destinations:

    Protein Data Bank Europe

    More...
    PDBei

    Protein Data Bank RCSB

    More...
    RCSB PDBi

    Protein Data Bank Japan

    More...
    PDBji
    Links Updated
    PDB entryMethodResolution (Å)ChainPositionsPDBsum
    2WWUX-ray2.15A115-483[»]
    3K3NX-ray2.40A122-483[»]
    3K3OX-ray2.10A122-483[»]
    3KV4X-ray2.19A37-483[»]
    4DO0X-ray2.55A115-483[»]
    ProteinModelPortaliQ9UPP1
    SMRiQ9UPP1
    ModBaseiSearch...
    MobiDBiSearch...

    Protein-protein interaction databases

    BioGridi116751, 83 interactors
    DIPiDIP-38913N
    IntActiQ9UPP1, 37 interactors
    MINTiQ9UPP1
    STRINGi9606.ENSP00000350676

    Chemistry databases

    BindingDBiQ9UPP1
    ChEMBLiCHEMBL1938212
    GuidetoPHARMACOLOGYi2698

    PTM databases

    iPTMnetiQ9UPP1
    PhosphoSitePlusiQ9UPP1
    SwissPalmiQ9UPP1

    Polymorphism and mutation databases

    BioMutaiPHF8
    DMDMi73620986

    Proteomic databases

    EPDiQ9UPP1
    PaxDbiQ9UPP1
    PeptideAtlasiQ9UPP1
    PRIDEiQ9UPP1
    ProteomicsDBi85394
    85395 [Q9UPP1-2]
    85396 [Q9UPP1-3]
    85397 [Q9UPP1-4]

    Protocols and materials databases

    Structural Biology KnowledgebaseSearch...

    Genome annotation databases

    EnsembliENST00000322659; ENSP00000319473; ENSG00000172943 [Q9UPP1-5]
    ENST00000338154; ENSP00000338868; ENSG00000172943 [Q9UPP1-2]
    ENST00000338946; ENSP00000340051; ENSG00000172943 [Q9UPP1-4]
    ENST00000357988; ENSP00000350676; ENSG00000172943 [Q9UPP1-1]
    GeneIDi23133
    KEGGihsa:23133
    UCSCiuc004dst.4 human [Q9UPP1-1]

    Organism-specific databases

    Comparative Toxicogenomics Database

    More...
    CTDi
    23133
    DisGeNETi23133
    EuPathDBiHostDB:ENSG00000172943.18

    GeneCards: human genes, protein and diseases

    More...
    GeneCardsi
    PHF8
    HGNCiHGNC:20672 PHF8
    HPAiHPA038779
    HPA062015
    MalaCardsiPHF8
    MIMi300263 phenotype
    300560 gene
    neXtProtiNX_Q9UPP1
    OpenTargetsiENSG00000172943
    Orphaneti85287 X-linked intellectual disability, Siderius type
    PharmGKBiPA134889361

    Human Unidentified Gene-Encoded large proteins database

    More...
    HUGEi
    Search...

    GenAtlas: human gene database

    More...
    GenAtlasi
    Search...

    Phylogenomic databases

    eggNOGiKOG1633 Eukaryota
    ENOG410XQXU LUCA
    GeneTreeiENSGT00940000157847
    HOGENOMiHOG000231232
    HOVERGENiHBG045631
    InParanoidiQ9UPP1
    KOiK19415
    OMAiLGTCFKD
    OrthoDBiEOG091G09DB
    PhylomeDBiQ9UPP1
    TreeFamiTF106480

    Enzyme and pathway databases

    ReactomeiR-HSA-2299718 Condensation of Prophase Chromosomes
    R-HSA-3214842 HDMs demethylate histones

    Miscellaneous databases

    ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

    More...
    ChiTaRSi
    PHF8 human
    EvolutionaryTraceiQ9UPP1

    The Gene Wiki collection of pages on human genes and proteins

    More...
    GeneWikii
    PHF8

    Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

    More...
    GenomeRNAii
    23133

    Protein Ontology

    More...
    PROi
    PR:Q9UPP1

    The Stanford Online Universal Resource for Clones and ESTs

    More...
    SOURCEi
    Search...

    Gene expression databases

    BgeeiENSG00000172943 Expressed in 196 organ(s), highest expression level in testis
    CleanExiHS_PHF8
    ExpressionAtlasiQ9UPP1 baseline and differential
    GenevisibleiQ9UPP1 HS

    Family and domain databases

    InterProiView protein in InterPro
    IPR003347 JmjC_dom
    IPR019786 Zinc_finger_PHD-type_CS
    IPR011011 Znf_FYVE_PHD
    IPR001965 Znf_PHD
    IPR019787 Znf_PHD-finger
    PfamiView protein in Pfam
    PF02373 JmjC, 1 hit
    PF00628 PHD, 1 hit
    SMARTiView protein in SMART
    SM00558 JmjC, 1 hit
    SM00249 PHD, 1 hit
    SUPFAMiSSF57903 SSF57903, 1 hit
    PROSITEiView protein in PROSITE
    PS51184 JMJC, 1 hit
    PS01359 ZF_PHD_1, 1 hit
    PS50016 ZF_PHD_2, 1 hit

    ProtoNet; Automatic hierarchical classification of proteins

    More...
    ProtoNeti
    Search...

    <p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

    <p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPHF8_HUMAN
    <p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9UPP1
    Secondary accession number(s): B3KMV4
    , B7Z911, Q5H9U5, Q5JPR9, Q5JPS0, Q5JPS2, Q5JPS3, Q5VUJ4, Q7Z6D4, Q9HAH2
    <p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 19, 2004
    Last sequence update: August 16, 2005
    Last modified: December 5, 2018
    This is version 157 of the entry and version 3 of the sequence. See complete history.
    <p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    <p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome X
      Human chromosome X: entries, gene names and cross-references to MIM
    2. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    3. SIMILARITY comments
      Index of protein domains and families
    4. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    5. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    6. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    UniProt is an ELIXIR core data resource
    Main funding by: National Institutes of Health

    We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

    Do not show this banner again