Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 186 (12 Aug 2020)
Sequence version 2 (07 Mar 2006)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

LIM/homeobox protein Lhx6

Gene

LHX6

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Probable transcription factor required for the expression of a subset of genes involved in interneurons migration and development. Functions in the specification of cortical interneuron subtypes and in the migration of GABAergic interneuron precursors from the subpallium to the cerebral cortex (By similarity).By similarity

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section specifies the position and type of each DNA-binding domain present within the protein.<p><a href='/help/dna_bind' target='_top'>More...</a></p>DNA bindingi219 – 278HomeoboxPROSITE-ProRule annotationAdd BLAST60

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDevelopmental protein, DNA-binding
Biological processDifferentiation, Neurogenesis, Transcription, Transcription regulation
LigandMetal-binding, Zinc

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q9UPM6

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
LIM/homeobox protein Lhx6
Short name:
LIM homeobox protein 6
Alternative name(s):
LIM/homeobox protein Lhx6.1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:LHX6
Synonyms:LHX6.1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 9

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000106852.15

Human Gene Nomenclature Database

More...
HGNCi
HGNC:21735, LHX6

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
608215, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9UPM6

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
26468

Open Targets

More...
OpenTargetsi
ENSG00000106852

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134949308

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q9UPM6, Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
LHX6

Domain mapping of disease mutations (DMDM)

More...
DMDMi
90185239

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000757941 – 363LIM/homeobox protein Lhx6Add BLAST363

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9UPM6

PRoteomics IDEntifications database

More...
PRIDEi
Q9UPM6

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
40476
85374 [Q9UPM6-1]
85375 [Q9UPM6-2]
85376 [Q9UPM6-3]
85377 [Q9UPM6-4]
85378 [Q9UPM6-5]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9UPM6

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9UPM6

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000106852, Expressed in anterior cingulate cortex and 165 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9UPM6, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9UPM6, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000106852, Tissue enhanced (brain)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with LDB1 (via the LIM zinc-binding domains).

By similarity

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
117692, 22 interactors

Protein interaction database and analysis system

More...
IntActi
Q9UPM6, 25 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000377854

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q9UPM6, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9UPM6

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini70 – 122LIM zinc-binding 1PROSITE-ProRule annotationAdd BLAST53
Domaini131 – 184LIM zinc-binding 2PROSITE-ProRule annotationAdd BLAST54

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni55 – 194Required for interaction with LDB1By similarityAdd BLAST140

Keywords - Domaini

Homeobox, LIM domain, Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0490, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000156868

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_027802_1_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9UPM6

KEGG Orthology (KO)

More...
KOi
K09375

Identification of Orthologs from Complete Genome Data

More...
OMAi
GCKANTR

Database of Orthologous Groups

More...
OrthoDBi
1161127at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9UPM6

TreeFam database of animal gene trees

More...
TreeFami
TF315442

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00086, homeodomain, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR009057, Homeobox-like_sf
IPR017970, Homeobox_CS
IPR001356, Homeobox_dom
IPR001781, Znf_LIM

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00046, Homeodomain, 1 hit
PF00412, LIM, 2 hits

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00389, HOX, 1 hit
SM00132, LIM, 2 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF46689, SSF46689, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00027, HOMEOBOX_1, 1 hit
PS50071, HOMEOBOX_2, 1 hit
PS00478, LIM_DOMAIN_1, 2 hits
PS50023, LIM_DOMAIN_2, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 6 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9UPM6-1) [UniParc]FASTAAdd to basket
Also known as: Lhx6.1a

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAQPGSGCKA TTRCLEGTAP PAMAQSDAEA LAGALDKDEG QASPCTPSTP
60 70 80 90 100
SVCSPPSAAS SVPSAGKNIC SSCGLEILDR YLLKVNNLIW HVRCLECSVC
110 120 130 140 150
RTSLRQQNSC YIKNKEIFCK MDYFSRFGTK CARCGRQIYA SDWVRRARGN
160 170 180 190 200
AYHLACFACF SCKRQLSTGE EFGLVEEKVL CRIHYDTMIE NLKRAAENGN
210 220 230 240 250
GLTLEGAVPS EQDSQPKPAK RARTSFTAEQ LQVMQAQFAQ DNNPDAQTLQ
260 270 280 290 300
KLADMTGLSR RVIQVWFQNC RARHKKHTPQ HPVPPSGAPP SRLPSALSDD
310 320 330 340 350
IHYTPFSSPE RARMVTLHGY IESQVQCGQV HCRLPYTAPP VHLKADMDGP
360
LSNRGEKVIL FQY
Length:363
Mass (Da):40,045
Last modified:March 7, 2006 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i3633B5112D548532
GO
Isoform 2 (identifier: Q9UPM6-2) [UniParc]FASTAAdd to basket
Also known as: Lhx6.1b

The sequence of this isoform differs from the canonical sequence as follows:
     324-363: QVQCGQVHCRLPYTAPPVHLKADMDGPLSNRGEKVILFQY → HPFSVLTLPALPHLPVGAPQLPLSR

Show »
Length:348
Mass (Da):38,193
Checksum:iDC0A3056BC56EF37
GO
Isoform 3 (identifier: Q9UPM6-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MYWKHENAAPALPEGCRLPAEGGPATDQVM

Show »
Length:392
Mass (Da):43,136
Checksum:iD2A915F07BFC73C0
GO
Isoform 4 (identifier: Q9UPM6-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MYWKHENAAPALPEGCRLPAEGGPATDQVM
     324-363: QVQCGQVHCRLPYTAPPVHLKADMDGPLSNRGEKVILFQY → HPFSVLTLPALPHLPVGAPQLPLSR

Show »
Length:377
Mass (Da):41,284
Checksum:i132637341D6A94B4
GO
Isoform 5 (identifier: Q9UPM6-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MRRGLCRRSAENPDAGPVM
     324-363: QVQCGQVHCRLPYTAPPVHLKADMDGPLSNRGEKVILFQY → HPFSVLTLPALPHLPVGAPQLPLSR

Show »
Length:366
Mass (Da):40,160
Checksum:iF78470DB966B0E28
GO
Isoform 6 (identifier: Q9UPM6-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-187: Missing.

Show »
Length:176
Mass (Da):19,618
Checksum:i58A580E0C2AEE8FD
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0YMH3H0YMH3_HUMAN
LIM/homeobox protein Lhx6
LHX6
33Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YMY8H0YMY8_HUMAN
LIM/homeobox protein Lhx6
LHX6
50Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YKH7H0YKH7_HUMAN
LIM/homeobox protein Lhx6
LHX6
35Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAI03937 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence AAI03938 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence CAB66505 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti16E → K in BAA83422 (PubMed:10393337).Curated1
Sequence conflicti16E → K in BAA83423 (PubMed:10393337).Curated1
Isoform 2 (identifier: Q9UPM6-2)
Sequence conflicti346L → F in BAA83423 (PubMed:10393337).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0460431 – 187Missing in isoform 6. 1 PublicationAdd BLAST187
Alternative sequenceiVSP_0377451M → MYWKHENAAPALPEGCRLPA EGGPATDQVM in isoform 3 and isoform 4. 1 Publication1
Alternative sequenceiVSP_0420731M → MRRGLCRRSAENPDAGPVM in isoform 5. 1 Publication1
Alternative sequenceiVSP_003109324 – 363QVQCG…ILFQY → HPFSVLTLPALPHLPVGAPQ LPLSR in isoform 2, isoform 4 and isoform 5. 2 PublicationsAdd BLAST40

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB031041 mRNA Translation: BAA83422.1
AB031042 mRNA Translation: BAA83423.1
AK126982 mRNA No translation available.
AK289827 mRNA Translation: BAF82516.1
AK297175 mRNA Translation: BAH12516.1
AK299709 mRNA Translation: BAH13108.1
AK313808 mRNA Translation: BAG36544.1
AL162424 Genomic DNA No translation available.
CH471090 Genomic DNA Translation: EAW87515.1
CH471090 Genomic DNA Translation: EAW87516.1
AL136570 mRNA Translation: CAB66505.1 Different initiation.
BC103936 mRNA Translation: AAI03937.1 Different initiation.
BC103937 mRNA Translation: AAI03938.1 Different initiation.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS56583.1 [Q9UPM6-1]
CCDS56584.1 [Q9UPM6-5]
CCDS59144.1 [Q9UPM6-6]
CCDS6837.2 [Q9UPM6-4]
CCDS6838.2 [Q9UPM6-3]
CCDS87683.1 [Q9UPM6-2]

Protein sequence database of the Protein Information Resource

More...
PIRi
T46907

NCBI Reference Sequences

More...
RefSeqi
NP_001229262.1, NM_001242333.1 [Q9UPM6-5]
NP_001229263.1, NM_001242334.1 [Q9UPM6-1]
NP_001229264.1, NM_001242335.1 [Q9UPM6-6]
NP_001335119.1, NM_001348190.1 [Q9UPM6-2]
NP_055183.2, NM_014368.4 [Q9UPM6-3]
NP_954629.2, NM_199160.3 [Q9UPM6-4]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000340587; ENSP00000340137; ENSG00000106852 [Q9UPM6-4]
ENST00000373754; ENSP00000362859; ENSG00000106852 [Q9UPM6-2]
ENST00000373755; ENSP00000362860; ENSG00000106852 [Q9UPM6-1]
ENST00000394319; ENSP00000377854; ENSG00000106852 [Q9UPM6-3]
ENST00000541397; ENSP00000441464; ENSG00000106852 [Q9UPM6-5]
ENST00000559895; ENSP00000475927; ENSG00000106852 [Q9UPM6-6]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
26468

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:26468

UCSC genome browser

More...
UCSCi
uc004blx.5, human [Q9UPM6-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB031041 mRNA Translation: BAA83422.1
AB031042 mRNA Translation: BAA83423.1
AK126982 mRNA No translation available.
AK289827 mRNA Translation: BAF82516.1
AK297175 mRNA Translation: BAH12516.1
AK299709 mRNA Translation: BAH13108.1
AK313808 mRNA Translation: BAG36544.1
AL162424 Genomic DNA No translation available.
CH471090 Genomic DNA Translation: EAW87515.1
CH471090 Genomic DNA Translation: EAW87516.1
AL136570 mRNA Translation: CAB66505.1 Different initiation.
BC103936 mRNA Translation: AAI03937.1 Different initiation.
BC103937 mRNA Translation: AAI03938.1 Different initiation.
CCDSiCCDS56583.1 [Q9UPM6-1]
CCDS56584.1 [Q9UPM6-5]
CCDS59144.1 [Q9UPM6-6]
CCDS6837.2 [Q9UPM6-4]
CCDS6838.2 [Q9UPM6-3]
CCDS87683.1 [Q9UPM6-2]
PIRiT46907
RefSeqiNP_001229262.1, NM_001242333.1 [Q9UPM6-5]
NP_001229263.1, NM_001242334.1 [Q9UPM6-1]
NP_001229264.1, NM_001242335.1 [Q9UPM6-6]
NP_001335119.1, NM_001348190.1 [Q9UPM6-2]
NP_055183.2, NM_014368.4 [Q9UPM6-3]
NP_954629.2, NM_199160.3 [Q9UPM6-4]

3D structure databases

SMRiQ9UPM6
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi117692, 22 interactors
IntActiQ9UPM6, 25 interactors
STRINGi9606.ENSP00000377854

PTM databases

iPTMnetiQ9UPM6
PhosphoSitePlusiQ9UPM6

Polymorphism and mutation databases

BioMutaiLHX6
DMDMi90185239

Proteomic databases

PaxDbiQ9UPM6
PRIDEiQ9UPM6
ProteomicsDBi40476
85374 [Q9UPM6-1]
85375 [Q9UPM6-2]
85376 [Q9UPM6-3]
85377 [Q9UPM6-4]
85378 [Q9UPM6-5]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
16061, 327 antibodies

The DNASU plasmid repository

More...
DNASUi
26468

Genome annotation databases

EnsembliENST00000340587; ENSP00000340137; ENSG00000106852 [Q9UPM6-4]
ENST00000373754; ENSP00000362859; ENSG00000106852 [Q9UPM6-2]
ENST00000373755; ENSP00000362860; ENSG00000106852 [Q9UPM6-1]
ENST00000394319; ENSP00000377854; ENSG00000106852 [Q9UPM6-3]
ENST00000541397; ENSP00000441464; ENSG00000106852 [Q9UPM6-5]
ENST00000559895; ENSP00000475927; ENSG00000106852 [Q9UPM6-6]
GeneIDi26468
KEGGihsa:26468
UCSCiuc004blx.5, human [Q9UPM6-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
26468
DisGeNETi26468
EuPathDBiHostDB:ENSG00000106852.15

GeneCards: human genes, protein and diseases

More...
GeneCardsi
LHX6
HGNCiHGNC:21735, LHX6
HPAiENSG00000106852, Tissue enhanced (brain)
MIMi608215, gene
neXtProtiNX_Q9UPM6
OpenTargetsiENSG00000106852
PharmGKBiPA134949308

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0490, Eukaryota
GeneTreeiENSGT00940000156868
HOGENOMiCLU_027802_1_0_1
InParanoidiQ9UPM6
KOiK09375
OMAiGCKANTR
OrthoDBi1161127at2759
PhylomeDBiQ9UPM6
TreeFamiTF315442

Enzyme and pathway databases

PathwayCommonsiQ9UPM6

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
26468, 3 hits in 892 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
LHX6, human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
LHX6

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
26468
PharosiQ9UPM6, Tbio

Protein Ontology

More...
PROi
PR:Q9UPM6
RNActiQ9UPM6, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000106852, Expressed in anterior cingulate cortex and 165 other tissues
ExpressionAtlasiQ9UPM6, baseline and differential
GenevisibleiQ9UPM6, HS

Family and domain databases

CDDicd00086, homeodomain, 1 hit
InterProiView protein in InterPro
IPR009057, Homeobox-like_sf
IPR017970, Homeobox_CS
IPR001356, Homeobox_dom
IPR001781, Znf_LIM
PfamiView protein in Pfam
PF00046, Homeodomain, 1 hit
PF00412, LIM, 2 hits
SMARTiView protein in SMART
SM00389, HOX, 1 hit
SM00132, LIM, 2 hits
SUPFAMiSSF46689, SSF46689, 1 hit
PROSITEiView protein in PROSITE
PS00027, HOMEOBOX_1, 1 hit
PS50071, HOMEOBOX_2, 1 hit
PS00478, LIM_DOMAIN_1, 2 hits
PS50023, LIM_DOMAIN_2, 2 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiLHX6_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9UPM6
Secondary accession number(s): A6PVQ1
, A6PVQ2, A8K1B2, B7Z4D0, H0YN76, Q5T7S7, Q5T7S8, Q9NTK3, Q9UPM5
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: March 7, 2006
Last modified: August 12, 2020
This is version 186 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  2. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again