Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 181 (22 Apr 2020)
Sequence version 2 (13 Dec 2002)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Solute carrier family 12 member 4

Gene

SLC12A4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Mediates electroneutral potassium-chloride cotransport when activated by cell swelling. May contribute to cell volume homeostasis in single cells. May be involved in the regulation of basolateral Cl- exit in NaCl absorbing epithelia (By similarity). Isoform 4 has no transport activity.By similarity

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Inhibited by WNK3.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processIon transport, Potassium transport, Symport, Transport
LigandChloride, Potassium

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-426117 Cation-coupled Chloride cotransporters

Protein family/group databases

Transport Classification Database

More...
TCDBi
2.A.30.1.17 the cation-chloride cotransporter (ccc) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Solute carrier family 12 member 4
Alternative name(s):
Electroneutral potassium-chloride cotransporter 1
Erythroid K-Cl cotransporter 1
Short name:
hKCC1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SLC12A4
Synonyms:KCC1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 16

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:10913 SLC12A4

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
604119 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9UP95

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 118CytoplasmicSequence analysisAdd BLAST118
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei119 – 139HelicalSequence analysisAdd BLAST21
Transmembranei149 – 169HelicalSequence analysisAdd BLAST21
Topological domaini170 – 214CytoplasmicSequence analysisAdd BLAST45
Transmembranei215 – 235HelicalSequence analysisAdd BLAST21
Transmembranei253 – 273HelicalSequence analysisAdd BLAST21
Topological domaini274 – 275CytoplasmicSequence analysis2
Transmembranei276 – 296HelicalSequence analysisAdd BLAST21
Transmembranei356 – 376HelicalSequence analysisAdd BLAST21
Topological domaini377 – 407CytoplasmicSequence analysisAdd BLAST31
Transmembranei408 – 428HelicalSequence analysisAdd BLAST21
Transmembranei453 – 473HelicalSequence analysisAdd BLAST21
Topological domaini474 – 493CytoplasmicSequence analysisAdd BLAST20
Transmembranei494 – 514HelicalSequence analysisAdd BLAST21
Transmembranei567 – 587HelicalSequence analysisAdd BLAST21
Topological domaini588 – 627CytoplasmicSequence analysisAdd BLAST40
Transmembranei628 – 648HelicalSequence analysisAdd BLAST21
Transmembranei845 – 865HelicalSequence analysisAdd BLAST21
Topological domaini866 – 1085CytoplasmicSequence analysisAdd BLAST220

Keywords - Cellular componenti

Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
6560

Open Targets

More...
OpenTargetsi
ENSG00000124067

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA35807

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q9UP95 Tbio

Chemistry databases

Drug and drug target database

More...
DrugBanki
DB00887 Bumetanide
DB00761 Potassium chloride

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
SLC12A4

Domain mapping of disease mutations (DMDM)

More...
DMDMi
27151691

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001780301 – 1085Solute carrier family 12 member 4Add BLAST1085

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei24PhosphoserineCombined sources1
Modified residuei47PhosphoserineBy similarity1
Modified residuei51PhosphoserineCombined sources1
Modified residuei81PhosphoserineBy similarity1
Modified residuei88PhosphoserineCombined sources1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi245N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi312N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi331N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi347N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi439N-linked (GlcNAc...) asparagineSequence analysis1
Modified residuei967PhosphoserineCombined sources1
Modified residuei983PhosphothreonineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

N-glycosylated.

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9UP95

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9UP95

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q9UP95

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9UP95

PeptideAtlas

More...
PeptideAtlasi
Q9UP95

PRoteomics IDEntifications database

More...
PRIDEi
Q9UP95

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
25245
25434
26226
85360 [Q9UP95-1]
85361 [Q9UP95-2]
85362 [Q9UP95-3]
85363 [Q9UP95-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9UP95

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9UP95

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Ubiquitous. Levels are much higher in erythrocytes from patients with Hb SC and Hb SS compared to normal AA erythrocytes. This may contribute to red blood cell dehydration and to the manifestation of sickle cell disease by increasing the intracellular concentration of HbS. Isoform 1 was not detected in circulating reticulocytes.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000124067 Expressed in heart left ventricle and 193 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9UP95 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9UP95 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000124067 Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homomultimer and heteromultimer with other K-Cl cotransporters.

1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Show more details

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
112449, 41 interactors

Protein interaction database and analysis system

More...
IntActi
Q9UP95, 33 interactors

Molecular INTeraction database

More...
MINTi
Q9UP95

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000395983

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q9UP95 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

11085
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9UP95

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi160 – 163Poly-Cys4

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the SLC12A transporter family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2082 Eukaryota
COG0531 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000157672

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_001883_1_1_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9UP95

KEGG Orthology (KO)

More...
KOi
K14427

Identification of Orthologs from Complete Genome Data

More...
OMAi
AQCDDYF

Database of Orthologous Groups

More...
OrthoDBi
349744at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9UP95

TreeFam database of animal gene trees

More...
TreeFami
TF313657

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR004841 AA-permease/SLC12A_dom
IPR000622 KCC1
IPR000076 KCL_cotranspt
IPR018491 SLC12_C
IPR004842 SLC12A_fam

The PANTHER Classification System

More...
PANTHERi
PTHR11827:SF46 PTHR11827:SF46, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00324 AA_permease, 2 hits
PF03522 SLC12, 2 hits

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR01081 KCLTRNSPORT
PR01082 KCLTRNSPORT1

TIGRFAMs; a protein family database

More...
TIGRFAMsi
TIGR00930 2a30, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (7+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 7 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Note: Experimental confirmation may be lacking for some isoforms.

This entry has 7 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9UP95-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPHFTVVPVD GPRRGDYDNL EGLSWVDYGE RAELDDSDGH GNHRESSPFL
60 70 80 90 100
SPLEASRGID YYDRNLALFE EELDIRPKVS SLLGKLVSYT NLTQGAKEHE
110 120 130 140 150
EAESGEGTRR RAAEAPSMGT LMGVYLPCLQ NIFGVILFLR LTWMVGTAGV
160 170 180 190 200
LQALLIVLIC CCCTLLTAIS MSAIATNGVV PAGGSYFMIS RSLGPEFGGA
210 220 230 240 250
VGLCFYLGTT FAAAMYILGA IEILLTYIAP PAAIFYPSGA HDTSNATLNN
260 270 280 290 300
MRVYGTIFLT FMTLVVFVGV KYVNKFASLF LACVIISILS IYAGGIKSIF
310 320 330 340 350
DPPVFPVCML GNRTLSRDQF DICAKTAVVD NETVATQLWS FFCHSPNLTT
360 370 380 390 400
DSCDPYFMLN NVTEIPGIPG AAAGVLQENL WSAYLEKGDI VEKHGLPSAD
410 420 430 440 450
APSLKESLPL YVVADIATSF TVLVGIFFPS VTGIMAGSNR SGDLRDAQKS
460 470 480 490 500
IPVGTILAII TTSLVYFSSV VLFGACIEGV VLRDKYGDGV SRNLVVGTLA
510 520 530 540 550
WPSPWVIVIG SFFSTCGAGL QSLTGAPRLL QAIAKDNIIP FLRVFGHGKV
560 570 580 590 600
NGEPTWALLL TALIAELGIL IASLDMVAPI LSMFFLMCYL FVNLACAVQT
610 620 630 640 650
LLRTPNWRPR FKYYHWALSF LGMSLCLALM FVSSWYYALV AMLIAGMIYK
660 670 680 690 700
YIEYQGAEKE WGDGIRGLSL SAARYALLRL EEGPPHTKNW RPQLLVLLKL
710 720 730 740 750
DEDLHVKYPR LLTFASQLKA GKGLTIVGSV IQGSFLESYG EAQAAEQTIK
760 770 780 790 800
NMMEIEKVKG FCQVVVASKV REGLAHLIQS CGLGGMRHNS VVLGWPYGWR
810 820 830 840 850
QSEDPRAWKT FIDTVRCTTA AHLALLVPKN IAFYPSNHER YLEGHIDVWW
860 870 880 890 900
IVHDGGMLML LPFLLRQHKV WRKCRMRIFT VAQMDDNSIQ MKKDLAVFLY
910 920 930 940 950
HLRLEAEVEV VEMHNSDISA YTYERTLMME QRSQMLRQMR LTKTEREREA
960 970 980 990 1000
QLVKDRHSAL RLESLYSDEE DESAVGADKI QMTWTRDKYM TETWDPSHAP
1010 1020 1030 1040 1050
DNFRELVHIK PDQSNVRRMH TAVKLNEVIV TRSHDARLVL LNMPGPPRNS
1060 1070 1080
EGDENYMEFL EVLTEGLERV LLVRGGGREV ITIYS
Length:1,085
Mass (Da):120,650
Last modified:December 13, 2002 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i42B590EC3D94EA4D
GO
Isoform 2 (identifier: Q9UP95-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1056-1068: YMEFLEVLTEGLE → CIPLWRGRQLGGG
     1069-1085: Missing.

Show »
Length:1,068
Mass (Da):118,620
Checksum:i7A1FB4FD47252C88
GO
Isoform 3 (identifier: Q9UP95-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1012-1085: Missing.

Show »
Length:1,011
Mass (Da):112,275
Checksum:i33860CBEC1BE578B
GO
Isoform 4 (identifier: Q9UP95-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     749-955: Missing.
     956-958: RHS → PCA
     963-987: ESLYSDEEDESAVGADKIQMTWTRD → PTWPCSCPRTSPSTPATTSATWRAT
     988-1085: Missing.

Show »
Length:780
Mass (Da):84,701
Checksum:i63DD249B6CA8689C
GO
Isoform 5 (identifier: Q9UP95-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-38: MPHFTVVPVDGPRRGDYDNLEGLSWVDYGERAELDDSD → MGDTLSP

Show »
Length:1,054
Mass (Da):117,046
Checksum:i328721D9B50DF738
GO
Isoform 6 (identifier: Q9UP95-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-38: MPHFTVVPVDGPRRGDYDNLEGLSWVDYGERAELDDSD → MAAEGAVCGFVYLEGTAWAVPEDTEPLASCTL

Show »
Length:1,079
Mass (Da):119,629
Checksum:iEC9A4E5C31C90A87
GO
Isoform 7 (identifier: Q9UP95-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-70: MPHFTVVPVD...YYDRNLALFE → MRAGGACRPG...GSAPSWMTRT

Show »
Length:1,087
Mass (Da):119,745
Checksum:i701F57E7F5732CBD
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
J3QRE2J3QRE2_HUMAN
Solute carrier family 12 member 4
SLC12A4
178Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
I3L4N6I3L4N6_HUMAN
Solute carrier family 12 member 4
SLC12A4
1,037Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3QSF2J3QSF2_HUMAN
Solute carrier family 12 member 4
SLC12A4
90Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
I3L1N8I3L1N8_HUMAN
Solute carrier family 12 member 4
SLC12A4
54Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3QKM4J3QKM4_HUMAN
Solute carrier family 12 member 4
SLC12A4
19Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAC35282 differs from that shown. Reason: Frameshift.Curated
The sequence BAG57330 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti42N → D in BAG61116 (PubMed:14702039).Curated1
Sequence conflicti211F → L in BAG63994 (PubMed:14702039).Curated1
Sequence conflicti288I → N in BAG63994 (PubMed:14702039).Curated1
Sequence conflicti370G → R in BAG57330 (PubMed:14702039).Curated1
Sequence conflicti697L → P in BAG63994 (PubMed:14702039).Curated1
Sequence conflicti1016V → A in BAG57330 (PubMed:14702039).Curated1
Sequence conflicti1055N → D in BAG57330 (PubMed:14702039).Curated1
Isoform 6 (identifier: Q9UP95-6)
Sequence conflicti4E → G in BAH14786 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0463691 – 70MPHFT…LALFE → MRAGGACRPGAAGTAAGTAA GGWDGGCGGAEPARCLTSPW CQWTGRGAATMTTSRGSVGW TTGSAPSWMTRT in isoform 7. 1 PublicationAdd BLAST70
Alternative sequenceiVSP_0445961 – 38MPHFT…LDDSD → MGDTLSP in isoform 5. 1 PublicationAdd BLAST38
Alternative sequenceiVSP_0461461 – 38MPHFT…LDDSD → MAAEGAVCGFVYLEGTAWAV PEDTEPLASCTL in isoform 6. 1 PublicationAdd BLAST38
Alternative sequenceiVSP_006108749 – 955Missing in isoform 4. 1 PublicationAdd BLAST207
Alternative sequenceiVSP_006109956 – 958RHS → PCA in isoform 4. 1 Publication3
Alternative sequenceiVSP_006110963 – 987ESLYS…TWTRD → PTWPCSCPRTSPSTPATTSA TWRAT in isoform 4. 1 PublicationAdd BLAST25
Alternative sequenceiVSP_006111988 – 1085Missing in isoform 4. 1 PublicationAdd BLAST98
Alternative sequenceiVSP_0061121012 – 1085Missing in isoform 3. 1 PublicationAdd BLAST74
Alternative sequenceiVSP_0061131056 – 1068YMEFL…TEGLE → CIPLWRGRQLGGG in isoform 2. 1 PublicationAdd BLAST13
Alternative sequenceiVSP_0061141069 – 1085Missing in isoform 2. 1 PublicationAdd BLAST17

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
U55054 mRNA Translation: AAC50563.1
AF047338 mRNA Translation: AAC32815.1
AF054505 mRNA Translation: AAC39684.1
AF054506 mRNA Translation: AAC39685.1
AK293956 mRNA Translation: BAG57330.1 Different initiation.
AK299042 mRNA Translation: BAG61116.1
AK302790 mRNA Translation: BAG63994.1
AK316415 mRNA Translation: BAH14786.1
AC040162 Genomic DNA No translation available.
BC021193 mRNA Translation: AAH21193.1
AF053402 mRNA Translation: AAC35282.1 Frameshift.
AY026038 mRNA Translation: AAK01946.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS10855.1 [Q9UP95-1]
CCDS54030.1 [Q9UP95-6]
CCDS54031.1 [Q9UP95-5]
CCDS54032.1 [Q9UP95-7]

NCBI Reference Sequences

More...
RefSeqi
NP_001139433.1, NM_001145961.1
NP_001139434.1, NM_001145962.1 [Q9UP95-7]
NP_001139435.1, NM_001145963.1 [Q9UP95-6]
NP_001139436.1, NM_001145964.1 [Q9UP95-5]
NP_005063.1, NM_005072.4 [Q9UP95-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000316341; ENSP00000318557; ENSG00000124067 [Q9UP95-1]
ENST00000422611; ENSP00000395983; ENSG00000124067 [Q9UP95-7]
ENST00000537830; ENSP00000445962; ENSG00000124067 [Q9UP95-6]
ENST00000541864; ENSP00000438334; ENSG00000124067 [Q9UP95-5]
ENST00000576616; ENSP00000458902; ENSG00000124067 [Q9UP95-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
6560

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:6560

UCSC genome browser

More...
UCSCi
uc002euz.2 human [Q9UP95-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U55054 mRNA Translation: AAC50563.1
AF047338 mRNA Translation: AAC32815.1
AF054505 mRNA Translation: AAC39684.1
AF054506 mRNA Translation: AAC39685.1
AK293956 mRNA Translation: BAG57330.1 Different initiation.
AK299042 mRNA Translation: BAG61116.1
AK302790 mRNA Translation: BAG63994.1
AK316415 mRNA Translation: BAH14786.1
AC040162 Genomic DNA No translation available.
BC021193 mRNA Translation: AAH21193.1
AF053402 mRNA Translation: AAC35282.1 Frameshift.
AY026038 mRNA Translation: AAK01946.1
CCDSiCCDS10855.1 [Q9UP95-1]
CCDS54030.1 [Q9UP95-6]
CCDS54031.1 [Q9UP95-5]
CCDS54032.1 [Q9UP95-7]
RefSeqiNP_001139433.1, NM_001145961.1
NP_001139434.1, NM_001145962.1 [Q9UP95-7]
NP_001139435.1, NM_001145963.1 [Q9UP95-6]
NP_001139436.1, NM_001145964.1 [Q9UP95-5]
NP_005063.1, NM_005072.4 [Q9UP95-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
6KKRelectron microscopy2.90A/B1-1085[»]
6KKTelectron microscopy2.90A/B1-1085[»]
6KKUelectron microscopy3.50A/B1-1085[»]
SMRiQ9UP95
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGridi112449, 41 interactors
IntActiQ9UP95, 33 interactors
MINTiQ9UP95
STRINGi9606.ENSP00000395983

Chemistry databases

DrugBankiDB00887 Bumetanide
DB00761 Potassium chloride

Protein family/group databases

TCDBi2.A.30.1.17 the cation-chloride cotransporter (ccc) family

PTM databases

iPTMnetiQ9UP95
PhosphoSitePlusiQ9UP95

Polymorphism and mutation databases

BioMutaiSLC12A4
DMDMi27151691

Proteomic databases

EPDiQ9UP95
jPOSTiQ9UP95
MassIVEiQ9UP95
PaxDbiQ9UP95
PeptideAtlasiQ9UP95
PRIDEiQ9UP95
ProteomicsDBi25245
25434
26226
85360 [Q9UP95-1]
85361 [Q9UP95-2]
85362 [Q9UP95-3]
85363 [Q9UP95-4]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
29685 166 antibodies

The DNASU plasmid repository

More...
DNASUi
6560

Genome annotation databases

EnsembliENST00000316341; ENSP00000318557; ENSG00000124067 [Q9UP95-1]
ENST00000422611; ENSP00000395983; ENSG00000124067 [Q9UP95-7]
ENST00000537830; ENSP00000445962; ENSG00000124067 [Q9UP95-6]
ENST00000541864; ENSP00000438334; ENSG00000124067 [Q9UP95-5]
ENST00000576616; ENSP00000458902; ENSG00000124067 [Q9UP95-2]
GeneIDi6560
KEGGihsa:6560
UCSCiuc002euz.2 human [Q9UP95-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
6560
DisGeNETi6560

GeneCards: human genes, protein and diseases

More...
GeneCardsi
SLC12A4
HGNCiHGNC:10913 SLC12A4
HPAiENSG00000124067 Low tissue specificity
MIMi604119 gene
neXtProtiNX_Q9UP95
OpenTargetsiENSG00000124067
PharmGKBiPA35807

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG2082 Eukaryota
COG0531 LUCA
GeneTreeiENSGT00940000157672
HOGENOMiCLU_001883_1_1_1
InParanoidiQ9UP95
KOiK14427
OMAiAQCDDYF
OrthoDBi349744at2759
PhylomeDBiQ9UP95
TreeFamiTF313657

Enzyme and pathway databases

ReactomeiR-HSA-426117 Cation-coupled Chloride cotransporters

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
SLC12A4 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
Chloride_potassium_symporter_4

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
6560
PharosiQ9UP95 Tbio

Protein Ontology

More...
PROi
PR:Q9UP95
RNActiQ9UP95 protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000124067 Expressed in heart left ventricle and 193 other tissues
ExpressionAtlasiQ9UP95 baseline and differential
GenevisibleiQ9UP95 HS

Family and domain databases

InterProiView protein in InterPro
IPR004841 AA-permease/SLC12A_dom
IPR000622 KCC1
IPR000076 KCL_cotranspt
IPR018491 SLC12_C
IPR004842 SLC12A_fam
PANTHERiPTHR11827:SF46 PTHR11827:SF46, 1 hit
PfamiView protein in Pfam
PF00324 AA_permease, 2 hits
PF03522 SLC12, 2 hits
PRINTSiPR01081 KCLTRNSPORT
PR01082 KCLTRNSPORT1
TIGRFAMsiTIGR00930 2a30, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiS12A4_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9UP95
Secondary accession number(s): B4DF69
, B4DR04, B4DZ82, B7ZAV0, F5H066, F5H0S9, F5H3C0, O60632, O75893, Q13953, Q96LD5
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 13, 2002
Last sequence update: December 13, 2002
Last modified: April 22, 2020
This is version 181 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again