Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 160 (08 May 2019)
Sequence version 1 (01 May 2000)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Multiple inositol polyphosphate phosphatase 1

Gene

MINPP1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Acts as a phosphoinositide 5- and phosphoinositide 6-phosphatase and regulates cellular levels of inositol pentakisphosphate (InsP5) and inositol hexakisphosphate (InsP6). Also acts as a 2,3-bisphosphoglycerate 3-phosphatase, by mediating the dephosphorylation of 2,3-bisphosphoglycerate (2,3-BPG) to produce phospho-D-glycerate without formation of 3-phosphoglycerate. May play a role in bone development (endochondral ossification). May play a role in the transition of chondrocytes from proliferation to hypertrophy (By similarity).By similarity1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the ‘Function’ section describes biophysical and chemical properties, such as maximal absorption, kinetic parameters, pH dependence, redox potentials and temperature dependence.<p><a href='/help/biophysicochemical_properties' target='_top'>More...</a></p>Kineticsi

  1. KM=0.61 mM for 2,3-bisphosphoglycerate1 Publication
  2. KM=90 µM for inositol hexakisphosphate1 Publication
  1. Vmax=15.8 nmol/min/mg enzyme with 2,3-bisphospho-D-glycerate as substrate1 Publication
  2. Vmax=6.2 nmol/min/mg enzyme with inositol hexakisphosphate as substrate1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei89By similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase

Enzyme and pathway databases

BioCyc Collection of Pathway/Genome Databases

More...
BioCyci
MetaCyc:HS03025-MONOMER

BRENDA Comprehensive Enzyme Information System

More...
BRENDAi
3.1.3.62 2681

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-1855231 Synthesis of IPs in the ER lumen

SABIO-RK: Biochemical Reaction Kinetics Database

More...
SABIO-RKi
Q9UNW1

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Multiple inositol polyphosphate phosphatase 1Imported (EC:3.1.3.621 Publication)
Alternative name(s):
2,3-bisphosphoglycerate 3-phosphatase1 Publication (EC:3.1.3.801 Publication)
Short name:
2,3-BPG phosphatase1 Publication
Inositol (1,3,4,5)-tetrakisphosphate 3-phosphatase
Short name:
Ins(1,3,4,5)P(4) 3-phosphatase
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:MINPP1
Synonyms:MIPP
ORF Names:UNQ900/PRO1917
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 10

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:7102 MINPP1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
605391 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9UNW1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Endoplasmic reticulum

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Thyroid cancer, non-medullary, 2 (NMTC2)1 Publication
Disease susceptibility is associated with variations affecting the gene represented in this entry.
Disease descriptionA form of non-medullary thyroid cancer (NMTC), a cancer characterized by tumors originating from the thyroid follicular cells. NMTCs represent approximately 95% of all cases of thyroid cancer and are classified into papillary, follicular, Hurthle cell, and anaplastic neoplasms.
Related information in OMIM
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_02283641S → L in NMTC2; somatic mutation. 1 PublicationCorresponds to variant dbSNP:rs119486096EnsemblClinVar.1
Natural variantiVAR_022837270Q → R in NMTC2. 1 PublicationCorresponds to variant dbSNP:rs104894171EnsemblClinVar.1

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi89H → A: Strong reduction of 2,3-bisphosphoglycerate 3-phosphatase activity. 1 Publication1
Mutagenesisi370H → A: Greatly diminishes phosphatase activity. 1 Publication1

Keywords - Diseasei

Disease mutation

Organism-specific databases

DisGeNET

More...
DisGeNETi
9562

MalaCards human disease database

More...
MalaCardsi
MINPP1
MIMi188470 phenotype

Open Targets

More...
OpenTargetsi
ENSG00000107789

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
319487 Familial papillary or follicular thyroid carcinoma

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA30820

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
MINPP1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
68565617

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 30By similarityAdd BLAST30
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000001958231 – 487Multiple inositol polyphosphate phosphatase 1Add BLAST457

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi242N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi481N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Glycoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9UNW1

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9UNW1

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9UNW1

PeptideAtlas

More...
PeptideAtlasi
Q9UNW1

PRoteomics IDEntifications database

More...
PRIDEi
Q9UNW1

ProteomicsDB human proteome resource

More...
ProteomicsDBi
85333
85334 [Q9UNW1-2]
85335 [Q9UNW1-3]

PTM databases

DEPOD human dephosphorylation database

More...
DEPODi
Q9UNW1

GlyConnect protein glycosylation platform

More...
GlyConnecti
1525

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9UNW1

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9UNW1

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Widely expressed with highest levels in kidney, liver and placenta.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000107789 Expressed in 214 organ(s), highest expression level in liver

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9UNW1 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA026859

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
114932, 19 interactors

Protein interaction database and analysis system

More...
IntActi
Q9UNW1, 3 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000361064

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi484 – 487Prevents secretion from ERPROSITE-ProRule annotation4

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Signal

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1382 Eukaryota
ENOG4111FS8 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000018409

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000113591

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9UNW1

KEGG Orthology (KO)

More...
KOi
K03103

Identification of Orthologs from Complete Genome Data

More...
OMAi
KLYQRYY

Database of Orthologous Groups

More...
OrthoDBi
1046588at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9UNW1

TreeFam database of animal gene trees

More...
TreeFami
TF324072

Family and domain databases

Conserved Domains Database

More...
CDDi
cd07061 HP_HAP_like, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.40.50.1240, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR000560 His_Pase_clade-2
IPR029033 His_PPase_superfam
IPR016274 Histidine_acid_Pase_euk

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00328 His_Phos_2, 1 hit

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF000894 Acid_phosphatase, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF53254 SSF53254, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00014 ER_TARGET, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q9UNW1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MLRAPGCLLR TSVAPAAALA AALLSSLARC SLLEPRDPVA SSLSPYFGTK
60 70 80 90 100
TRYEDVNPVL LSGPEAPWRD PELLEGTCTP VQLVALIRHG TRYPTVKQIR
110 120 130 140 150
KLRQLHGLLQ ARGSRDGGAS STGSRDLGAA LADWPLWYAD WMDGQLVEKG
160 170 180 190 200
RQDMRQLALR LASLFPALFS RENYGRLRLI TSSKHRCMDS SAAFLQGLWQ
210 220 230 240 250
HYHPGLPPPD VADMEFGPPT VNDKLMRFFD HCEKFLTEVE KNATALYHVE
260 270 280 290 300
AFKTGPEMQN ILKKVAATLQ VPVNDLNADL IQVAFFTCSF DLAIKGVKSP
310 320 330 340 350
WCDVFDIDDA KVLEYLNDLK QYWKRGYGYT INSRSSCTLF QDIFQHLDKA
360 370 380 390 400
VEQKQRSQPI SSPVILQFGH AETLLPLLSL MGYFKDKEPL TAYNYKKQMH
410 420 430 440 450
RKFRSGLIVP YASNLIFVLY HCENAKTPKE QFRVQMLLNE KVLPLAYSQE
460 470 480
TVSFYEDLKN HYKDILQSCQ TSEECELARA NSTSDEL
Length:487
Mass (Da):55,051
Last modified:May 1, 2000 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i89B8F347885B320A
GO
Isoform 2 (identifier: Q9UNW1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     279-312: DLIQVAFFTCSFDLAIKGVKSPWCDVFDIDDAKV → GLSQFLLQSSSSLVMQRLFFHCFLSWATSKTRNP
     313-487: Missing.

Note: No experimental confirmation available.
Show »
Length:312
Mass (Da):34,661
Checksum:iDC950F3E7144F13B
GO
Isoform 3 (identifier: Q9UNW1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     279-284: DLIQVA → GIRIFK
     285-487: Missing.

Note: No experimental confirmation available.
Show »
Length:284
Mass (Da):31,475
Checksum:i0F4BC3ED1B4BFF67
GO
Isoform 4 (identifier: Q9UNW1-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-213: MLRAPGCLLR...PGLPPPDVAD → MCLFQLCGLVRY

Note: No experimental confirmation available.
Show »
Length:286
Mass (Da):33,100
Checksum:iB48950FD3549CEEB
GO

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAD93056 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti81V → A in CAB43673 (PubMed:11230166).Curated1
Sequence conflicti111A → P in AAD02437 (PubMed:10087200).Curated1
Sequence conflicti132A → R in AAD02437 (PubMed:10087200).Curated1
Sequence conflicti156 – 157QL → HV in AAD02437 (PubMed:10087200).Curated2
Sequence conflicti344F → S in CAB43673 (PubMed:11230166).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_02283641S → L in NMTC2; somatic mutation. 1 PublicationCorresponds to variant dbSNP:rs119486096EnsemblClinVar.1
Natural variantiVAR_022837270Q → R in NMTC2. 1 PublicationCorresponds to variant dbSNP:rs104894171EnsemblClinVar.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0445691 – 213MLRAP…PDVAD → MCLFQLCGLVRY in isoform 4. 1 PublicationAdd BLAST213
Alternative sequenceiVSP_014552279 – 312DLIQV…DDAKV → GLSQFLLQSSSSLVMQRLFF HCFLSWATSKTRNP in isoform 2. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_014553279 – 284DLIQVA → GIRIFK in isoform 3. 1 Publication6
Alternative sequenceiVSP_014554285 – 487Missing in isoform 3. 1 PublicationAdd BLAST203
Alternative sequenceiVSP_014555313 – 487Missing in isoform 2. 1 PublicationAdd BLAST175

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF084943 mRNA Translation: AAD09751.1
AF084944 mRNA Translation: AAD09752.1
AF046914 mRNA Translation: AAD02437.1
AL050356 mRNA Translation: CAB43673.1
AY358938 mRNA Translation: AAQ89297.1
AK309176 mRNA No translation available.
AB209819 mRNA Translation: BAD93056.1 Different initiation.
AL138767 Genomic DNA No translation available.
AL355334 Genomic DNA No translation available.
BC032504 mRNA Translation: AAH32504.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS53551.1 [Q9UNW1-2]
CCDS53552.1 [Q9UNW1-4]
CCDS7384.1 [Q9UNW1-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001171588.1, NM_001178117.1 [Q9UNW1-2]
NP_001171589.1, NM_001178118.1 [Q9UNW1-4]
NP_004888.2, NM_004897.4 [Q9UNW1-1]
XP_011538681.1, XM_011540379.2 [Q9UNW1-4]
XP_016872455.1, XM_017016966.1

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000371994; ENSP00000361062; ENSG00000107789 [Q9UNW1-2]
ENST00000371996; ENSP00000361064; ENSG00000107789 [Q9UNW1-1]
ENST00000536010; ENSP00000437823; ENSG00000107789 [Q9UNW1-4]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
9562

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:9562

UCSC genome browser

More...
UCSCi
uc001keu.4 human [Q9UNW1-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF084943 mRNA Translation: AAD09751.1
AF084944 mRNA Translation: AAD09752.1
AF046914 mRNA Translation: AAD02437.1
AL050356 mRNA Translation: CAB43673.1
AY358938 mRNA Translation: AAQ89297.1
AK309176 mRNA No translation available.
AB209819 mRNA Translation: BAD93056.1 Different initiation.
AL138767 Genomic DNA No translation available.
AL355334 Genomic DNA No translation available.
BC032504 mRNA Translation: AAH32504.1
CCDSiCCDS53551.1 [Q9UNW1-2]
CCDS53552.1 [Q9UNW1-4]
CCDS7384.1 [Q9UNW1-1]
RefSeqiNP_001171588.1, NM_001178117.1 [Q9UNW1-2]
NP_001171589.1, NM_001178118.1 [Q9UNW1-4]
NP_004888.2, NM_004897.4 [Q9UNW1-1]
XP_011538681.1, XM_011540379.2 [Q9UNW1-4]
XP_016872455.1, XM_017016966.1

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGridi114932, 19 interactors
IntActiQ9UNW1, 3 interactors
STRINGi9606.ENSP00000361064

PTM databases

DEPODiQ9UNW1
GlyConnecti1525
iPTMnetiQ9UNW1
PhosphoSitePlusiQ9UNW1

Polymorphism and mutation databases

BioMutaiMINPP1
DMDMi68565617

Proteomic databases

EPDiQ9UNW1
jPOSTiQ9UNW1
PaxDbiQ9UNW1
PeptideAtlasiQ9UNW1
PRIDEiQ9UNW1
ProteomicsDBi85333
85334 [Q9UNW1-2]
85335 [Q9UNW1-3]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
9562
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000371994; ENSP00000361062; ENSG00000107789 [Q9UNW1-2]
ENST00000371996; ENSP00000361064; ENSG00000107789 [Q9UNW1-1]
ENST00000536010; ENSP00000437823; ENSG00000107789 [Q9UNW1-4]
GeneIDi9562
KEGGihsa:9562
UCSCiuc001keu.4 human [Q9UNW1-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
9562
DisGeNETi9562

GeneCards: human genes, protein and diseases

More...
GeneCardsi
MINPP1
HGNCiHGNC:7102 MINPP1
HPAiHPA026859
MalaCardsiMINPP1
MIMi188470 phenotype
605391 gene
neXtProtiNX_Q9UNW1
OpenTargetsiENSG00000107789
Orphaneti319487 Familial papillary or follicular thyroid carcinoma
PharmGKBiPA30820

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1382 Eukaryota
ENOG4111FS8 LUCA
GeneTreeiENSGT00390000018409
HOGENOMiHOG000113591
InParanoidiQ9UNW1
KOiK03103
OMAiKLYQRYY
OrthoDBi1046588at2759
PhylomeDBiQ9UNW1
TreeFamiTF324072

Enzyme and pathway databases

BioCyciMetaCyc:HS03025-MONOMER
BRENDAi3.1.3.62 2681
ReactomeiR-HSA-1855231 Synthesis of IPs in the ER lumen
SABIO-RKiQ9UNW1

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
MINPP1 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
MINPP1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
9562

Protein Ontology

More...
PROi
PR:Q9UNW1

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000107789 Expressed in 214 organ(s), highest expression level in liver
GenevisibleiQ9UNW1 HS

Family and domain databases

CDDicd07061 HP_HAP_like, 1 hit
Gene3Di3.40.50.1240, 1 hit
InterProiView protein in InterPro
IPR000560 His_Pase_clade-2
IPR029033 His_PPase_superfam
IPR016274 Histidine_acid_Pase_euk
PfamiView protein in Pfam
PF00328 His_Phos_2, 1 hit
PIRSFiPIRSF000894 Acid_phosphatase, 1 hit
SUPFAMiSSF53254 SSF53254, 1 hit
PROSITEiView protein in PROSITE
PS00014 ER_TARGET, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMINP1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9UNW1
Secondary accession number(s): F5H683
, O95172, O95286, Q59EJ2, Q9UGA3
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 5, 2005
Last sequence update: May 1, 2000
Last modified: May 8, 2019
This is version 160 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again