Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q9UNP9 (PPIE_HUMAN)

Entry version 193 (16 Oct 2019)
Sequence version 1 (01 May 2000)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Peptidyl-prolyl cis-trans isomerase E

Gene

PPIE

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Involved in pre-mRNA splicing as component of the spliceosome (PubMed:11991638, PubMed:28076346). Combines RNA-binding and PPIase activities (PubMed:8977107, PubMed:18258190, PubMed:20677832, PubMed:20460131). Binds mRNA and has a preference for single-stranded RNA molecules with poly-A and poly-U stretches, suggesting it binds to the poly(A)-region in the 3'-UTR of mRNA molecules (PubMed:8977107, PubMed:18258190, PubMed:20460131). Catalyzes the cis-trans isomerization of proline imidic peptide bonds in proteins (PubMed:8977107, PubMed:18258190, PubMed:20677832, PubMed:20541251). Inhibits KMT2A activity; this requires proline isomerase activity (PubMed:20677832, PubMed:20541251, PubMed:20460131).7 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Enzyme activity is inhibited by cyclosporin A.2 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionIsomerase, RNA-binding, Rotamase
Biological processmRNA processing, mRNA splicing

Enzyme and pathway databases

BRENDA Comprehensive Enzyme Information System

More...BRENDAi		5.2.1.8 2681

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-6781823 Formation of TC-NER Pre-Incision Complex
R-HSA-6781827 Transcription-Coupled Nucleotide Excision Repair (TC-NER)
R-HSA-6782135 Dual incision in TC-NER
R-HSA-6782210 Gap-filling DNA repair synthesis and ligation in TC-NER
R-HSA-6798695 Neutrophil degranulation
R-HSA-72163 mRNA Splicing - Major Pathway

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Peptidyl-prolyl cis-trans isomerase E (EC:5.2.1.84 Publications)
Short name:
PPIase E
Alternative name(s):
Cyclophilin E
Cyclophilin-331 Publication
Rotamase E
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:PPIE
Synonyms:CYP331 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:9258 PPIE

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		602435 gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q9UNP9

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus, Spliceosome

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi9Y → A: Decreased affinity for RNA. 1 Publication1
Mutagenesisi39L → A: Decreased affinity for KMT2A. 2 Publications1
Mutagenesisi40 – 45Missing : Abolishes interaction with KMT2A. 1 Publication6
Mutagenesisi42E → A: Slightly decreased affinity for KMT2A. 1 Publication1
Mutagenesisi45K → A: No effect on interaction with KMT2A. 1 Publication1
Mutagenesisi47R → A: No effect on interaction with KMT2A. 2 Publications1
Mutagenesisi49F → A: Strongly decreased affinity for KMT2A. Decreased affinity for RNA. 2 Publications1
Mutagenesisi51F → A: Impairs protein folding. 2 Publications1
Mutagenesisi51F → D: Abolishes interaction with KMT2A. Abolishes inhibition of KMT2A activity. 1 Publication1
Mutagenesisi191R → A: Expected to disrupt proline isomerase activity. Abolishes inhibition of KMT2A activity; when associated with A-196. 1 Publication1
Mutagenesisi196 – 197FM → EE: Expected to disrupt peptidylproline binding. Decreases interaction with KMT2A. Abolishes inhibition of KMT2A activity. 1 Publication2
Mutagenesisi196F → A: Expected to disrupt proline isomerase activity. Abolishes inhibition of KMT2A activity; when associated with A-191. 1 Publication1

Organism-specific databases

DisGeNET

More...DisGeNETi		10450

Open Targets

More...OpenTargetsi		ENSG00000084072

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA33583

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q9UNP9

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		PPIE

Domain mapping of disease mutations (DMDM)

More...DMDMi		13124097

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000641571 – 301Peptidyl-prolyl cis-trans isomerase EAdd BLAST301

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei91PhosphoserineCombined sources1
Modified residuei97PhosphoserineCombined sources1
Modified residuei119PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q9UNP9

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q9UNP9

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q9UNP9

PeptideAtlas

More...PeptideAtlasi		Q9UNP9

PRoteomics IDEntifications database

More...PRIDEi		Q9UNP9

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		65110
85321 [Q9UNP9-1]
85322 [Q9UNP9-2]

Consortium for Top Down Proteomics

More...TopDownProteomicsi		Q9UNP9-1 [Q9UNP9-1]
Q9UNP9-2 [Q9UNP9-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q9UNP9

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q9UNP9

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Found in all the examined tissues including heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000084072 Expressed in 227 organ(s), highest expression level in right testis

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q9UNP9 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q9UNP9 HS

Organism-specific databases

Human Protein Atlas

More...HPAi		HPA019357
HPA020131

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Identified in the spliceosome C complex (PubMed:11991638, PubMed:28076346).

Component of the XAB2 complex, a multimeric protein complex composed of XAB2, PRPF19, AQR, ZNF830, ISY1, and PPIE (PubMed:17981804).

Identified in a pentameric intron-binding (IB) complex composed of AQR, XAB2, ISY1, ZNF830 and PPIE that is incorporated into the spliceosome as a preassembled complex (PubMed:25599396). The IB complex does not contain PRPF19 (PubMed:25599396).

Interacts (via RNA-binding domain) with KMT2A (via the third PHD-type zinc-finger) (PubMed:20677832, PubMed:20541251, PubMed:20460131).

7 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...BioGridi		115714, 224 interactors

CORUM comprehensive resource of mammalian protein complexes

More...CORUMi		Q9UNP9

Database of interacting proteins

More...DIPi		DIP-34757N

Protein interaction database and analysis system

More...IntActi		Q9UNP9, 57 interactors

Molecular INTeraction database

More...MINTi		Q9UNP9

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000361918

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1301
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q9UNP9

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		Q9UNP9

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini6 – 84RRMPROSITE-ProRule annotationAdd BLAST79
Domaini143 – 299PPIase cyclophilin-typePROSITE-ProRule annotationAdd BLAST157

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi60 – 63Poly-Ala4

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The RRM domain mediates both interaction with RNA and with KMT2A (via the third PHD-type zinc-finger), but has much higher affinity for the KMT2A PHD-type zinc-finger.2 Publications

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the cyclophilin-type PPIase family. PPIase E subfamily.Curated

Phylogenomic databases

Ensembl GeneTree

More...GeneTreei		ENSGT00940000158790

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		HOG000065981

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q9UNP9

KEGG Orthology (KO)

More...KOi		K09564

Identification of Orthologs from Complete Genome Data

More...OMAi		TVSMANC

Database of Orthologous Groups

More...OrthoDBi		1484092at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q9UNP9

TreeFam database of animal gene trees

More...TreeFami		TF313817

Family and domain databases

Conserved Domains Database

More...CDDi		cd12347 RRM_PPIE, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		2.40.100.10, 1 hit
3.30.70.330, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR029000 Cyclophilin-like_dom_sf
IPR020892 Cyclophilin-type_PPIase_CS
IPR002130 Cyclophilin-type_PPIase_dom
IPR012677 Nucleotide-bd_a/b_plait_sf
IPR016304 PPIE
IPR034168 PPIE_RRM
IPR035979 RBD_domain_sf
IPR000504 RRM_dom

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00160 Pro_isomerase, 1 hit
PF00076 RRM_1, 1 hit

PIRSF; a whole-protein classification database

More...PIRSFi		PIRSF001475 PPI_cyclophilin_E, 1 hit

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR00153 CSAPPISMRASE

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00360 RRM, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF50891 SSF50891, 1 hit
SSF54928 SSF54928, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS00170 CSA_PPIASE_1, 1 hit
PS50072 CSA_PPIASE_2, 1 hit
PS50102 RRM, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 7 potential isoforms that are computationally mapped.Show allAlign All

Isoform A (identifier: Q9UNP9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MATTKRVLYV GGLAEEVDDK VLHAAFIPFG DITDIQIPLD YETEKHRGFA 
        60         70         80         90        100
FVEFELAEDA AAAIDNMNES ELFGRTIRVN LAKPMRIKEG SSRPVWSDDD 
       110        120        130        140        150
WLKKFSGKTL EENKEEEGSE PPKAETQEGE PIAKKARSNP QVYMDIKIGN 
       160        170        180        190        200
KPAGRIQMLL RSDVVPMTAE NFRCLCTHEK GFGFKGSSFH RIIPQFMCQG 
       210        220        230        240        250
GDFTNHNGTG GKSIYGKKFD DENFILKHTG PGLLSMANSG PNTNGSQFFL 
       260        270        280        290        300
TCDKTDWLDG KHVVFGEVTE GLDVLRQIEA QGSKDGKPKQ KVIIADCGEY 

V
Length:301
Mass (Da):33,431
Last modified:May 1, 2000 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iF3226149A790BA42
GO
Isoform B (identifier: Q9UNP9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     280-301: AQGSKDGKPKQKVIIADCGEYV → KQEESAITSQPRSWKLT

Show »
Length:296
Mass (Da):33,085
Checksum:iB70A7F239825B54D
GO
Isoform 3 (identifier: Q9UNP9-3) [UniParc]FASTAAdd to basket
Also known as: Cyclophilin-33B

The sequence of this isoform differs from the canonical sequence as follows:
     280-301: AQGSKDGKPKQKVIIADCGEYV → VAPDTKASKARGSRKNKDGQERNWGKSQKVESHTI

Show »
Length:314
Mass (Da):34,991
Checksum:iC5D0CFB2673046D7
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 7 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9PEQ6E9PEQ6_HUMAN
Peptidyl-prolyl cis-trans isomerase
PPIE
250Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PKY5E9PKY5_HUMAN
Peptidyl-prolyl cis-trans isomerase
PPIE
213Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PK21E9PK21_HUMAN
Peptidyl-prolyl cis-trans isomerase...
PPIE
208Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PIB0E9PIB0_HUMAN
Peptidyl-prolyl cis-trans isomerase...
PPIE
71Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PMH0E9PMH0_HUMAN
Peptidyl-prolyl cis-trans isomerase...
PPIE
38Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YCV4H0YCV4_HUMAN
Peptidyl-prolyl cis-trans isomerase...
PPIE
37Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YE31H0YE31_HUMAN
Peptidyl-prolyl cis-trans isomerase...
PPIE
36Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti151K → R in AAZ93379 (Ref. 3) Curated1
Sequence conflicti207N → D in AAZ93379 (Ref. 3) Curated1
Sequence conflicti287K → N in AAC00006 (Ref. 2) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_046370280 – 301AQGSK…CGEYV → VAPDTKASKARGSRKNKDGQ ERNWGKSQKVESHTI in isoform 3. 1 PublicationAdd BLAST22
Alternative sequenceiVSP_005181280 – 301AQGSK…CGEYV → KQEESAITSQPRSWKLT in isoform B. 2 PublicationsAdd BLAST22

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AF104012 mRNA Translation: AAD19906.1
AF104013 mRNA Translation: AAD19907.1
AF042385 mRNA Translation: AAC00006.1
AF042386 mRNA Translation: AAC00007.1
DQ160195 mRNA Translation: AAZ93379.1
AK313666 mRNA Translation: BAG36418.1
AL049824 Genomic DNA No translation available.
AL033527 Genomic DNA No translation available.
AL035404 Genomic DNA No translation available.
CH471059 Genomic DNA Translation: EAX07255.1
BC004898 mRNA Translation: AAH04898.1
BC008451 mRNA Translation: AAH08451.1
BC107736 mRNA Translation: AAI07737.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS442.1 [Q9UNP9-2]
CCDS443.1 [Q9UNP9-1]
CCDS53299.1 [Q9UNP9-3]

Protein sequence database of the Protein Information Resource

More...PIRi		S66681

NCBI Reference Sequences

More...RefSeqi		NP_001181936.1, NM_001195007.1 [Q9UNP9-3]
NP_006103.1, NM_006112.3 [Q9UNP9-1]
NP_982281.1, NM_203456.2 [Q9UNP9-2]
XP_016855540.1, XM_017000051.1 [Q9UNP9-3]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000324379; ENSP00000312769; ENSG00000084072 [Q9UNP9-1]
ENST00000356511; ENSP00000348904; ENSG00000084072 [Q9UNP9-2]
ENST00000372830; ENSP00000361918; ENSG00000084072 [Q9UNP9-3]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		10450

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:10450

UCSC genome browser

More...UCSCi		uc001cds.3 human [Q9UNP9-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF104012 mRNA Translation: AAD19906.1
AF104013 mRNA Translation: AAD19907.1
AF042385 mRNA Translation: AAC00006.1
AF042386 mRNA Translation: AAC00007.1
DQ160195 mRNA Translation: AAZ93379.1
AK313666 mRNA Translation: BAG36418.1
AL049824 Genomic DNA No translation available.
AL033527 Genomic DNA No translation available.
AL035404 Genomic DNA No translation available.
CH471059 Genomic DNA Translation: EAX07255.1
BC004898 mRNA Translation: AAH04898.1
BC008451 mRNA Translation: AAH08451.1
BC107736 mRNA Translation: AAI07737.1
CCDSiCCDS442.1 [Q9UNP9-2]
CCDS443.1 [Q9UNP9-1]
CCDS53299.1 [Q9UNP9-3]
PIRiS66681
RefSeqiNP_001181936.1, NM_001195007.1 [Q9UNP9-3]
NP_006103.1, NM_006112.3 [Q9UNP9-1]
NP_982281.1, NM_203456.2 [Q9UNP9-2]
XP_016855540.1, XM_017000051.1 [Q9UNP9-3]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1ZMFX-ray1.88A137-301[»]
2CQBNMR-A1-89[»]
2KU7NMR-A2-82[»]
2KYXNMR-A3-83[»]
2R99X-ray1.61A131-301[»]
3LPYX-ray2.00A/B5-82[»]
3MDFX-ray1.85A/B1-83[»]
3UCHX-ray2.50A129-301[»]
5MQFelectron microscopy5.90o1-301[»]
5YZGelectron microscopy4.1011-301[»]
5Z56electron microscopy5.10y1-301[»]
5Z57electron microscopy6.50y1-301[»]
6FF7electron microscopy4.50o1-301[»]
6ICZelectron microscopy3.00y1-301[»]
6ID0electron microscopy2.90y1-301[»]
6ID1electron microscopy2.86y1-301[»]
SMRiQ9UNP9
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGridi115714, 224 interactors
CORUMiQ9UNP9
DIPiDIP-34757N
IntActiQ9UNP9, 57 interactors
MINTiQ9UNP9
STRINGi9606.ENSP00000361918

PTM databases

iPTMnetiQ9UNP9
PhosphoSitePlusiQ9UNP9

Polymorphism and mutation databases

BioMutaiPPIE
DMDMi13124097

Proteomic databases

EPDiQ9UNP9
jPOSTiQ9UNP9
MassIVEiQ9UNP9
PeptideAtlasiQ9UNP9
PRIDEiQ9UNP9
ProteomicsDBi65110
85321 [Q9UNP9-1]
85322 [Q9UNP9-2]
TopDownProteomicsiQ9UNP9-1 [Q9UNP9-1]
Q9UNP9-2 [Q9UNP9-2]

Protocols and materials databases

The DNASU plasmid repository

More...DNASUi		10450

Genome annotation databases

EnsembliENST00000324379; ENSP00000312769; ENSG00000084072 [Q9UNP9-1]
ENST00000356511; ENSP00000348904; ENSG00000084072 [Q9UNP9-2]
ENST00000372830; ENSP00000361918; ENSG00000084072 [Q9UNP9-3]
GeneIDi10450
KEGGihsa:10450
UCSCiuc001cds.3 human [Q9UNP9-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		10450
DisGeNETi10450

GeneCards: human genes, protein and diseases

More...GeneCardsi		PPIE
HGNCiHGNC:9258 PPIE
HPAiHPA019357
HPA020131
MIMi602435 gene
neXtProtiNX_Q9UNP9
OpenTargetsiENSG00000084072
PharmGKBiPA33583

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

GeneTreeiENSGT00940000158790
HOGENOMiHOG000065981
InParanoidiQ9UNP9
KOiK09564
OMAiTVSMANC
OrthoDBi1484092at2759
PhylomeDBiQ9UNP9
TreeFamiTF313817

Enzyme and pathway databases

BRENDAi5.2.1.8 2681
ReactomeiR-HSA-6781823 Formation of TC-NER Pre-Incision Complex
R-HSA-6781827 Transcription-Coupled Nucleotide Excision Repair (TC-NER)
R-HSA-6782135 Dual incision in TC-NER
R-HSA-6782210 Gap-filling DNA repair synthesis and ligation in TC-NER
R-HSA-6798695 Neutrophil degranulation
R-HSA-72163 mRNA Splicing - Major Pathway

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		PPIE human
EvolutionaryTraceiQ9UNP9

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		PPIE_(gene)

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		10450
PharosiQ9UNP9

Protein Ontology

More...PROi		PR:Q9UNP9

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000084072 Expressed in 227 organ(s), highest expression level in right testis
ExpressionAtlasiQ9UNP9 baseline and differential
GenevisibleiQ9UNP9 HS

Family and domain databases

CDDicd12347 RRM_PPIE, 1 hit
Gene3Di2.40.100.10, 1 hit
3.30.70.330, 1 hit
InterProiView protein in InterPro
IPR029000 Cyclophilin-like_dom_sf
IPR020892 Cyclophilin-type_PPIase_CS
IPR002130 Cyclophilin-type_PPIase_dom
IPR012677 Nucleotide-bd_a/b_plait_sf
IPR016304 PPIE
IPR034168 PPIE_RRM
IPR035979 RBD_domain_sf
IPR000504 RRM_dom
PfamiView protein in Pfam
PF00160 Pro_isomerase, 1 hit
PF00076 RRM_1, 1 hit
PIRSFiPIRSF001475 PPI_cyclophilin_E, 1 hit
PRINTSiPR00153 CSAPPISMRASE
SMARTiView protein in SMART
SM00360 RRM, 1 hit
SUPFAMiSSF50891 SSF50891, 1 hit
SSF54928 SSF54928, 1 hit
PROSITEiView protein in PROSITE
PS00170 CSA_PPIASE_1, 1 hit
PS50072 CSA_PPIASE_2, 1 hit
PS50102 RRM, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPPIE_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9UNP9
Secondary accession number(s): B2R971
, O43634, O43635, Q32Q72, Q3S611, Q5TGA0, Q5TGA2, Q5TGA3, Q9UIZ5
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 21, 2001
Last sequence update: May 1, 2000
Last modified: October 16, 2019
This is version 193 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again