Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Sorting nexin-7

Gene

SNX7

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

May be involved in several stages of intracellular trafficking.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei73Phosphatidylinositol 3-phosphateBy similarity1
Binding sitei99Phosphatidylinositol 3-phosphateBy similarity1
Binding sitei108Phosphatidylinositol 3-phosphateBy similarity1
Binding sitei117Phosphatidylinositol 3-phosphateBy similarity1

GO - Molecular functioni

GO - Biological processi

Keywordsi

Biological processProtein transport, Transport
LigandLipid-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Sorting nexin-7
Gene namesi
Name:SNX7
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

EuPathDBiHostDB:ENSG00000162627.16
HGNCiHGNC:14971 SNX7
MIMi614904 gene
neXtProtiNX_Q9UNH6

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasmic vesicle, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi51375
OpenTargetsiENSG00000162627
PharmGKBiPA37947

Polymorphism and mutation databases

BioMutaiSNX7
DMDMi12643904

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002138481 – 387Sorting nexin-7Add BLAST387

Proteomic databases

EPDiQ9UNH6
PaxDbiQ9UNH6
PeptideAtlasiQ9UNH6
PRIDEiQ9UNH6
ProteomicsDBi85293
85294 [Q9UNH6-2]
85295 [Q9UNH6-3]

PTM databases

iPTMnetiQ9UNH6
PhosphoSitePlusiQ9UNH6

Expressioni

Gene expression databases

BgeeiENSG00000162627 Expressed in 219 organ(s), highest expression level in neocortex
CleanExiHS_SNX7
ExpressionAtlasiQ9UNH6 baseline and differential
GenevisibleiQ9UNH6 HS

Organism-specific databases

HPAiHPA037419
HPA054338

Interactioni

Binary interactionsi

Protein-protein interaction databases

BioGridi119508, 11 interactors
IntActiQ9UNH6, 16 interactors
MINTiQ9UNH6
STRINGi9606.ENSP00000304429

Structurei

Secondary structure

1387
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliQ9UNH6
SMRiQ9UNH6
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9UNH6

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini30 – 151PXPROSITE-ProRule annotationAdd BLAST122

Sequence similaritiesi

Belongs to the sorting nexin family.Curated

Phylogenomic databases

eggNOGiKOG2273 Eukaryota
COG5391 LUCA
GeneTreeiENSGT00910000144107
HOVERGENiHBG009723
InParanoidiQ9UNH6
KOiK17921
OMAiKCCKATE
OrthoDBiEOG091G08JS
PhylomeDBiQ9UNH6
TreeFamiTF328543

Family and domain databases

Gene3Di1.20.1270.60, 1 hit
3.30.1520.10, 1 hit
InterProiView protein in InterPro
IPR027267 AH/BAR_dom_sf
IPR001683 Phox
IPR036871 PX_dom_sf
IPR028656 SNX7
IPR039358 Sorting_nexin-like
PANTHERiPTHR10555 PTHR10555, 1 hit
PTHR10555:SF21 PTHR10555:SF21, 1 hit
PfamiView protein in Pfam
PF00787 PX, 1 hit
SMARTiView protein in SMART
SM00312 PX, 1 hit
SUPFAMiSSF64268 SSF64268, 1 hit
PROSITEiView protein in PROSITE
PS50195 PX, 1 hit

Sequences (3+)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9UNH6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDMNSFSPMM PTSPLSMINQ IKFEDEPDLK DLFITVDEPE SHVTTIETFI
60 70 80 90 100
TYRIITKTSR GEFDSSEFEV RRRYQDFLWL KGKLEEAHPT LIIPPLPEKF
110 120 130 140 150
IVKGMVERFN DDFIETRRKA LHKFLNRIAD HPTLTFNEDF KIFLTAQAWE
160 170 180 190 200
LSSHKKQGPG LLSRMGQTVR AVASSMRGVK NRPEEFMEMN NFIELFSQKI
210 220 230 240 250
NLIDKISQRI YKEEREYFDE MKEYGPIHIL WSASEEDLVD TLKDVASCID
260 270 280 290 300
RCCKATEKRM SGLSEALLPV VHEYVLYSEM LMGVMKRRDQ IQAELDSKVE
310 320 330 340 350
VLTYKKADTD LLPEEIGKLE DKVECANNAL KADWERWKQN MQNDIKLAFT
360 370 380
DMAEENIHYY EQCLATWESF LTSQTNLHLE EASEDKP
Length:387
Mass (Da):45,303
Last modified:May 1, 2000 - v1
Checksum:iE703B3EC6013DC1F
GO
Isoform 2 (identifier: Q9UNH6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     312-362: Missing.

Show »
Length:336
Mass (Da):39,207
Checksum:iAAE0BE2FA7BF4616
GO
Isoform 3 (identifier: Q9UNH6-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MEGERRASQAPSSGLPAGGANGESPGGGAPFPGSSGSSALLQAEVLDLDEDEDDLEVFSKDASLM

Show »
Length:451
Mass (Da):51,619
Checksum:i9BCBE544F8C3AAA4
GO

Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9PNL2E9PNL2_HUMAN
Sorting nexin-7
SNX7
396Annotation score:
B7ZC83B7ZC83_HUMAN
Sorting nexin-7
SNX7
108Annotation score:
E9PLE1E9PLE1_HUMAN
Sorting nexin-7
SNX7
36Annotation score:

Sequence cautioni

The sequence AAD27830 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAD96949 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti59S → T in BAD96949 (PubMed:14702039).Curated1
Sequence conflicti105M → I in CAB43229 (PubMed:17974005).Curated1
Sequence conflicti108 – 109RF → PG in CN483413 (Ref. 8) Curated2
Sequence conflicti153S → P in AAH10349 (PubMed:15489334).Curated1
Sequence conflicti165M → T in CAB43229 (PubMed:17974005).Curated1
Sequence conflicti199K → R in BAD96949 (PubMed:14702039).Curated1
Sequence conflicti324E → G in CAB43229 (PubMed:17974005).Curated1
Sequence conflicti370F → L in CAB43229 (PubMed:17974005).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_057331186F → L. Corresponds to variant dbSNP:rs35391040Ensembl.1
Natural variantiVAR_057332278S → N. Corresponds to variant dbSNP:rs12033678Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0390441M → MEGERRASQAPSSGLPAGGA NGESPGGGAPFPGSSGSSAL LQAEVLDLDEDEDDLEVFSK DASLM in isoform 3. 1 Publication1
Alternative sequenceiVSP_006191312 – 362Missing in isoform 2. 2 PublicationsAdd BLAST51

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
BT006747 mRNA Translation: AAP35393.1
AK223229 mRNA Translation: BAD96949.1 Different initiation.
AK293018 mRNA Translation: BAF85707.1
AL627442 Genomic DNA No translation available.
CH471097 Genomic DNA Translation: EAW72995.1
CH471097 Genomic DNA Translation: EAW72996.1
CH471097 Genomic DNA Translation: EAW72997.1
CH471097 Genomic DNA Translation: EAW72998.1
BC010349 mRNA Translation: AAH10349.1
BC018105 mRNA Translation: AAH18105.1
AF121857 mRNA Translation: AAD27830.1 Different initiation.
AL049989 mRNA Translation: CAB43229.1
CN483413 mRNA No translation available.
CCDSiCCDS755.2 [Q9UNH6-3]
RefSeqiNP_057060.2, NM_015976.4 [Q9UNH6-3]
NP_689424.2, NM_152238.3
XP_006710741.1, XM_006710678.2 [Q9UNH6-1]
XP_011539866.1, XM_011541564.2 [Q9UNH6-1]
XP_016856914.1, XM_017001425.1 [Q9UNH6-1]
XP_016856915.1, XM_017001426.1 [Q9UNH6-1]
XP_016856916.1, XM_017001427.1 [Q9UNH6-1]
XP_016856917.1, XM_017001428.1 [Q9UNH6-2]
UniGeneiHs.197015

Genome annotation databases

EnsembliENST00000306121; ENSP00000304429; ENSG00000162627 [Q9UNH6-3]
GeneIDi51375
KEGGihsa:51375
UCSCiuc010ouc.3 human [Q9UNH6-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
BT006747 mRNA Translation: AAP35393.1
AK223229 mRNA Translation: BAD96949.1 Different initiation.
AK293018 mRNA Translation: BAF85707.1
AL627442 Genomic DNA No translation available.
CH471097 Genomic DNA Translation: EAW72995.1
CH471097 Genomic DNA Translation: EAW72996.1
CH471097 Genomic DNA Translation: EAW72997.1
CH471097 Genomic DNA Translation: EAW72998.1
BC010349 mRNA Translation: AAH10349.1
BC018105 mRNA Translation: AAH18105.1
AF121857 mRNA Translation: AAD27830.1 Different initiation.
AL049989 mRNA Translation: CAB43229.1
CN483413 mRNA No translation available.
CCDSiCCDS755.2 [Q9UNH6-3]
RefSeqiNP_057060.2, NM_015976.4 [Q9UNH6-3]
NP_689424.2, NM_152238.3
XP_006710741.1, XM_006710678.2 [Q9UNH6-1]
XP_011539866.1, XM_011541564.2 [Q9UNH6-1]
XP_016856914.1, XM_017001425.1 [Q9UNH6-1]
XP_016856915.1, XM_017001426.1 [Q9UNH6-1]
XP_016856916.1, XM_017001427.1 [Q9UNH6-1]
XP_016856917.1, XM_017001428.1 [Q9UNH6-2]
UniGeneiHs.197015

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3IQ2X-ray1.70A/B25-154[»]
ProteinModelPortaliQ9UNH6
SMRiQ9UNH6
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi119508, 11 interactors
IntActiQ9UNH6, 16 interactors
MINTiQ9UNH6
STRINGi9606.ENSP00000304429

PTM databases

iPTMnetiQ9UNH6
PhosphoSitePlusiQ9UNH6

Polymorphism and mutation databases

BioMutaiSNX7
DMDMi12643904

Proteomic databases

EPDiQ9UNH6
PaxDbiQ9UNH6
PeptideAtlasiQ9UNH6
PRIDEiQ9UNH6
ProteomicsDBi85293
85294 [Q9UNH6-2]
85295 [Q9UNH6-3]

Protocols and materials databases

DNASUi51375
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000306121; ENSP00000304429; ENSG00000162627 [Q9UNH6-3]
GeneIDi51375
KEGGihsa:51375
UCSCiuc010ouc.3 human [Q9UNH6-1]

Organism-specific databases

CTDi51375
DisGeNETi51375
EuPathDBiHostDB:ENSG00000162627.16
GeneCardsiSNX7
HGNCiHGNC:14971 SNX7
HPAiHPA037419
HPA054338
MIMi614904 gene
neXtProtiNX_Q9UNH6
OpenTargetsiENSG00000162627
PharmGKBiPA37947
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG2273 Eukaryota
COG5391 LUCA
GeneTreeiENSGT00910000144107
HOVERGENiHBG009723
InParanoidiQ9UNH6
KOiK17921
OMAiKCCKATE
OrthoDBiEOG091G08JS
PhylomeDBiQ9UNH6
TreeFamiTF328543

Miscellaneous databases

ChiTaRSiSNX7 human
EvolutionaryTraceiQ9UNH6
GenomeRNAii51375
PROiPR:Q9UNH6
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000162627 Expressed in 219 organ(s), highest expression level in neocortex
CleanExiHS_SNX7
ExpressionAtlasiQ9UNH6 baseline and differential
GenevisibleiQ9UNH6 HS

Family and domain databases

Gene3Di1.20.1270.60, 1 hit
3.30.1520.10, 1 hit
InterProiView protein in InterPro
IPR027267 AH/BAR_dom_sf
IPR001683 Phox
IPR036871 PX_dom_sf
IPR028656 SNX7
IPR039358 Sorting_nexin-like
PANTHERiPTHR10555 PTHR10555, 1 hit
PTHR10555:SF21 PTHR10555:SF21, 1 hit
PfamiView protein in Pfam
PF00787 PX, 1 hit
SMARTiView protein in SMART
SM00312 PX, 1 hit
SUPFAMiSSF64268 SSF64268, 1 hit
PROSITEiView protein in PROSITE
PS50195 PX, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiSNX7_HUMAN
AccessioniPrimary (citable) accession number: Q9UNH6
Secondary accession number(s): A8KAF3
, D3DT50, Q53FQ3, Q5VT09, Q5VT10, Q86U82, Q8WVD4, Q96FW9, Q9Y3Z7
Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: May 1, 2000
Last modified: September 12, 2018
This is version 152 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. SIMILARITY comments
    Index of protein domains and families
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  6. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again