Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 157 (13 Feb 2019)
Sequence version 1 (01 May 2000)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Dual specificity protein phosphatase CDC14A

Gene

CDC14A

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Dual-specificity phosphatase. Required for centrosome separation and productive cytokinesis during cell division. Dephosphorylates SIRT2 around early anaphase. May dephosphorylate the APC subunit FZR1/CDH1, thereby promoting APC-FZR1 dependent degradation of mitotic cyclins and subsequent exit from mitosis. Required for normal hearing (PubMed:29293958).5 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei278Phosphocysteine intermediatePROSITE-ProRule annotation1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase, Protein phosphatase
Biological processCell cycle, Cell division, Hearing

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-176407 Conversion from APC/C:Cdc20 to APC/C:Cdh1 in late anaphase
R-HSA-5687128 MAPK6/MAPK4 signaling

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q9UNH5

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Dual specificity protein phosphatase CDC14A (EC:3.1.3.16, EC:3.1.3.48)
Alternative name(s):
CDC14 cell division cycle 14 homolog A
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CDC14A
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000079335.18

Human Gene Nomenclature Database

More...
HGNCi
HGNC:1718 CDC14A

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
603504 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9UNH5

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell projection, Cytoplasm, Cytoskeleton, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Deafness, autosomal recessive 32, with or without immotile sperm (DFNB32)2 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA form of non-syndromic sensorineural hearing loss. Sensorineural deafness results from damage to the neural receptors of the inner ear, the nerve pathways to the brain, or the area of the brain that receives sound information. DFNB32 is characterized by prelingual, progressive, moderate to profound sensorineural deafness. Some affected men are infertile.
See also OMIM:608653
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_081127139 – 594Missing in DFNB32. 1 PublicationAdd BLAST456
Natural variantiVAR_081128312R → G in DFNB32. 1 Publication1
Natural variantiVAR_081129312R → Q in DFNB32. 1 PublicationCorresponds to variant dbSNP:rs369245990EnsemblClinVar.1
Natural variantiVAR_081130320Q → P in DFNB32. 1 PublicationCorresponds to variant dbSNP:rs1339709390Ensembl.1
Natural variantiVAR_081131339 – 594Missing in DFNB32. 1 PublicationAdd BLAST256
Natural variantiVAR_081132345 – 594Missing in DFNB32. 1 PublicationAdd BLAST250
Natural variantiVAR_081133376 – 594Missing in DFNB32. 2 PublicationsAdd BLAST219

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi251D → A: Loss of phosphatase activity. 1 Publication1
Mutagenesisi278C → S: Loss of phosphatase activity. 2 Publications1
Mutagenesisi284R → A: Loss of phosphatase activity. 1 Publication1
Mutagenesisi362M → A: Inappropriate nucleolar localization; when associated with A-364. 1 Publication1
Mutagenesisi364I → A: Inappropriate nucleolar localization; when associated with A-362. 1 Publication1

Keywords - Diseasei

Deafness, Disease mutation, Non-syndromic deafness

Organism-specific databases

DisGeNET

More...
DisGeNETi
8556

MalaCards human disease database

More...
MalaCardsi
CDC14A
MIMi608653 phenotype

Open Targets

More...
OpenTargetsi
ENSG00000079335

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
90636 Autosomal recessive non-syndromic sensorineural deafness type DFNB

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA26254

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL1772926

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
CDC14A

Domain mapping of disease mutations (DMDM)

More...
DMDMi
55976620

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000948761 – 594Dual specificity protein phosphatase CDC14AAdd BLAST594

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei484PhosphoserineCombined sources1
Modified residuei583PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9UNH5

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9UNH5

PeptideAtlas

More...
PeptideAtlasi
Q9UNH5

PRoteomics IDEntifications database

More...
PRIDEi
Q9UNH5

ProteomicsDB human proteome resource

More...
ProteomicsDBi
85289
85290 [Q9UNH5-2]
85291 [Q9UNH5-3]
85292 [Q9UNH5-4]

PTM databases

DEPOD human dephosphorylation database

More...
DEPODi
Q9UNH5

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9UNH5

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9UNH5

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000079335 Expressed in 172 organ(s), highest expression level in sperm

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9UNH5 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9UNH5 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA023783

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with KIF20A, which is required to localize CDC14 to the midzone of the mitotic spindle.1 Publication

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
114126, 55 interactors

Protein interaction database and analysis system

More...
IntActi
Q9UNH5, 2 interactors

Molecular INTeraction database

More...
MINTi
Q9UNH5

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000354916

Chemistry databases

BindingDB database of measured binding affinities

More...
BindingDBi
Q9UNH5

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q9UNH5

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9UNH5

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni7 – 162AAdd BLAST156
Regioni163 – 176LinkerAdd BLAST14
Regioni177 – 343BAdd BLAST167

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

Composed of two structurally equivalent A and B domains that adopt a dual specificity protein phosphatase (DSP) fold.By similarity

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1720 Eukaryota
COG2453 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000155899

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000198341

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG050818

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9UNH5

KEGG Orthology (KO)

More...
KOi
K06639

Identification of Orthologs from Complete Genome Data

More...
OMAi
YHELNNN

Database of Orthologous Groups

More...
OrthoDBi
1357618at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9UNH5

TreeFam database of animal gene trees

More...
TreeFami
TF101053

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.90.190.10, 2 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR029260 DSPn
IPR000340 Dual-sp_phosphatase_cat-dom
IPR026068 Dual_Pase_CDC14A
IPR029021 Prot-tyrosine_phosphatase-like
IPR016130 Tyr_Pase_AS
IPR003595 Tyr_Pase_cat
IPR000387 TYR_PHOSPHATASE_dom
IPR020422 TYR_PHOSPHATASE_DUAL_dom

The PANTHER Classification System

More...
PANTHERi
PTHR23339:SF77 PTHR23339:SF77, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00782 DSPc, 1 hit
PF14671 DSPn, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00195 DSPc, 1 hit
SM00404 PTPc_motif, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF52799 SSF52799, 2 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00383 TYR_PHOSPHATASE_1, 1 hit
PS50056 TYR_PHOSPHATASE_2, 1 hit
PS50054 TYR_PHOSPHATASE_DUAL, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 8 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9UNH5-1) [UniParc]FASTAAdd to basket
Also known as: CDC14A1

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAAESGELIG ACEFMKDRLY FATLRNRPKS TVNTHYFSID EELVYENFYA
60 70 80 90 100
DFGPLNLAMV YRYCCKLNKK LKSYSLSRKK IVHYTCFDQR KRANAAFLIG
110 120 130 140 150
AYAVIYLKKT PEEAYRALLS GSNPPYLPFR DASFGNCTYN LTILDCLQGI
160 170 180 190 200
RKGLQHGFFD FETFDVDEYE HYERVENGDF NWIVPGKFLA FSGPHPKSKI
210 220 230 240 250
ENGYPLHAPE AYFPYFKKHN VTAVVRLNKK IYEAKRFTDA GFEHYDLFFI
260 270 280 290 300
DGSTPSDNIV RRFLNICENT EGAIAVHCKA GLGRTGTLIA CYVMKHYRFT
310 320 330 340 350
HAEIIAWIRI CRPGSIIGPQ QHFLEEKQAS LWVQGDIFRS KLKNRPSSEG
360 370 380 390 400
SINKILSGLD DMSIGGNLSK TQNMERFGED NLEDDDVEMK NGITQGDKLR
410 420 430 440 450
ALKSQRQPRT SPSCAFRSDD TKGHPRAVSQ PFRLSSSLQG SAVTLKTSKM
460 470 480 490 500
ALSPSATAKR INRTSLSSGA TVRSFSINSR LASSLGNLNA ATDDPENKKT
510 520 530 540 550
SSSSKAGFTA SPFTNLLNGS SQPTTRNYPE LNNNQYNRSS NSNGGNLNSP
560 570 580 590
PGPHSAKTEE HTTILRPSYT GLSSSSARFL SRSIPSLQSE YVHY
Length:594
Mass (Da):66,574
Last modified:May 1, 2000 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iD5552E2BAEEA84DF
GO
Isoform 2 (identifier: Q9UNH5-2) [UniParc]FASTAAdd to basket
Also known as: CDC14A2

The sequence of this isoform differs from the canonical sequence as follows:
     586-594: SLQSEYVHY → VSAQTPPPGPQNPECNFCALPSQPRLPPKKFNSAKEAF

Show »
Length:623
Mass (Da):69,543
Checksum:iCAB2041A59DB3350
GO
Isoform 3 (identifier: Q9UNH5-3) [UniParc]FASTAAdd to basket
Also known as: CDC14A3

The sequence of this isoform differs from the canonical sequence as follows:
     380-383: DNLE → VSFP
     384-594: Missing.

Show »
Length:383
Mass (Da):43,908
Checksum:i28295D04793D00B7
GO
Isoform 4 (identifier: Q9UNH5-4) [UniParc]FASTAAdd to basket
Also known as: CDC14A4

The sequence of this isoform differs from the canonical sequence as follows:
     174-191: RVENGDFNWIVPGKFLAF → VILFTPLKPTFLISKSIM
     192-594: Missing.

Note: No experimental confirmation available.
Show »
Length:191
Mass (Da):22,175
Checksum:i14E97BCF291E4D81
GO
Isoform 5 (identifier: Q9UNH5-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     586-594: SLQSEYVHY → CSCLLLVFRKPFLGSPLLSLPISHL

Show »
Length:610
Mass (Da):68,203
Checksum:iCA0AC7B44CAE4947
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 8 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0U1RQX7A0A0U1RQX7_HUMAN
Dual-specificity protein phosphatas...
CDC14A
565Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2R8YDJ8A0A2R8YDJ8_HUMAN
Dual-specificity protein phosphatas...
CDC14A
624Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2R8Y5L8A0A2R8Y5L8_HUMAN
Dual-specificity protein phosphatas...
CDC14A
334Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2R8Y6L0A0A2R8Y6L0_HUMAN
Dual-specificity protein phosphatas...
CDC14A
552Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2R8YEK7A0A2R8YEK7_HUMAN
Dual-specificity protein phosphatas...
CDC14A
333Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JSP6C9JSP6_HUMAN
Dual-specificity protein phosphatas...
CDC14A
187Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2R8Y3W8A0A2R8Y3W8_HUMAN
Dual-specificity protein phosphatas...
CDC14A
163Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2R8YGM0A0A2R8YGM0_HUMAN
Dual-specificity protein phosphatas...
CDC14A
87Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAB88277 differs from that shown. Reason: Frameshift at position 6.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti164F → I in AAB88277 (PubMed:9367992).Curated1
Sequence conflicti182W → C in AAB88277 (PubMed:9367992).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_081127139 – 594Missing in DFNB32. 1 PublicationAdd BLAST456
Natural variantiVAR_081128312R → G in DFNB32. 1 Publication1
Natural variantiVAR_081129312R → Q in DFNB32. 1 PublicationCorresponds to variant dbSNP:rs369245990EnsemblClinVar.1
Natural variantiVAR_081130320Q → P in DFNB32. 1 PublicationCorresponds to variant dbSNP:rs1339709390Ensembl.1
Natural variantiVAR_081131339 – 594Missing in DFNB32. 1 PublicationAdd BLAST256
Natural variantiVAR_081132345 – 594Missing in DFNB32. 1 PublicationAdd BLAST250
Natural variantiVAR_019957345R → Q1 PublicationCorresponds to variant dbSNP:rs28364897Ensembl.1
Natural variantiVAR_081133376 – 594Missing in DFNB32. 2 PublicationsAdd BLAST219
Natural variantiVAR_035655493D → Y in a colorectal cancer sample; somatic mutation. 1 Publication1
Natural variantiVAR_019958589S → F1 PublicationCorresponds to variant dbSNP:rs28364923Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_012322174 – 191RVENG…KFLAF → VILFTPLKPTFLISKSIM in isoform 4. 1 PublicationAdd BLAST18
Alternative sequenceiVSP_012323192 – 594Missing in isoform 4. 1 PublicationAdd BLAST403
Alternative sequenceiVSP_012035380 – 383DNLE → VSFP in isoform 3. 2 Publications4
Alternative sequenceiVSP_012036384 – 594Missing in isoform 3. 2 PublicationsAdd BLAST211
Alternative sequenceiVSP_012037586 – 594SLQSEYVHY → VSAQTPPPGPQNPECNFCAL PSQPRLPPKKFNSAKEAF in isoform 2. 1 Publication9
Alternative sequenceiVSP_047597586 – 594SLQSEYVHY → CSCLLLVFRKPFLGSPLLSL PISHL in isoform 5. 1 Publication9

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF000367 mRNA Translation: AAB88277.1 Frameshift.
AF122013 mRNA Translation: AAD49217.1
AF064102 mRNA Translation: AAC16659.1
AF064103 mRNA Translation: AAC16660.1
DQ530256 mRNA Translation: ABF74568.1
AY623111 Genomic DNA Translation: AAT38107.1
AC104457 Genomic DNA No translation available.
AL589990 Genomic DNA No translation available.
CH471097 Genomic DNA Translation: EAW72956.1
CH471097 Genomic DNA Translation: EAW72958.1
CH471097 Genomic DNA Translation: EAW72959.1
BC038979 mRNA Translation: AAH38979.1
BC093916 mRNA Translation: AAH93916.1
BC093918 mRNA Translation: AAH93918.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS769.1 [Q9UNH5-1]
CCDS770.1 [Q9UNH5-2]
CCDS771.1 [Q9UNH5-3]
CCDS86000.1 [Q9UNH5-5]

NCBI Reference Sequences

More...
RefSeqi
NP_001306139.1, NM_001319210.1 [Q9UNH5-5]
NP_001306140.1, NM_001319211.1
NP_001306141.1, NM_001319212.1
NP_003663.2, NM_003672.3 [Q9UNH5-1]
NP_201569.1, NM_033312.2 [Q9UNH5-2]
NP_201570.1, NM_033313.2 [Q9UNH5-3]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.127411

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000336454; ENSP00000336739; ENSG00000079335 [Q9UNH5-1]
ENST00000361544; ENSP00000354916; ENSG00000079335 [Q9UNH5-2]
ENST00000370124; ENSP00000359142; ENSG00000079335 [Q9UNH5-3]
ENST00000644813; ENSP00000496374; ENSG00000079335 [Q9UNH5-5]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
8556

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:8556

UCSC genome browser

More...
UCSCi
uc001dte.5 human [Q9UNH5-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

NIEHS-SNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF000367 mRNA Translation: AAB88277.1 Frameshift.
AF122013 mRNA Translation: AAD49217.1
AF064102 mRNA Translation: AAC16659.1
AF064103 mRNA Translation: AAC16660.1
DQ530256 mRNA Translation: ABF74568.1
AY623111 Genomic DNA Translation: AAT38107.1
AC104457 Genomic DNA No translation available.
AL589990 Genomic DNA No translation available.
CH471097 Genomic DNA Translation: EAW72956.1
CH471097 Genomic DNA Translation: EAW72958.1
CH471097 Genomic DNA Translation: EAW72959.1
BC038979 mRNA Translation: AAH38979.1
BC093916 mRNA Translation: AAH93916.1
BC093918 mRNA Translation: AAH93918.1
CCDSiCCDS769.1 [Q9UNH5-1]
CCDS770.1 [Q9UNH5-2]
CCDS771.1 [Q9UNH5-3]
CCDS86000.1 [Q9UNH5-5]
RefSeqiNP_001306139.1, NM_001319210.1 [Q9UNH5-5]
NP_001306140.1, NM_001319211.1
NP_001306141.1, NM_001319212.1
NP_003663.2, NM_003672.3 [Q9UNH5-1]
NP_201569.1, NM_033312.2 [Q9UNH5-2]
NP_201570.1, NM_033313.2 [Q9UNH5-3]
UniGeneiHs.127411

3D structure databases

ProteinModelPortaliQ9UNH5
SMRiQ9UNH5
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi114126, 55 interactors
IntActiQ9UNH5, 2 interactors
MINTiQ9UNH5
STRINGi9606.ENSP00000354916

Chemistry databases

BindingDBiQ9UNH5
ChEMBLiCHEMBL1772926

PTM databases

DEPODiQ9UNH5
iPTMnetiQ9UNH5
PhosphoSitePlusiQ9UNH5

Polymorphism and mutation databases

BioMutaiCDC14A
DMDMi55976620

Proteomic databases

jPOSTiQ9UNH5
PaxDbiQ9UNH5
PeptideAtlasiQ9UNH5
PRIDEiQ9UNH5
ProteomicsDBi85289
85290 [Q9UNH5-2]
85291 [Q9UNH5-3]
85292 [Q9UNH5-4]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000336454; ENSP00000336739; ENSG00000079335 [Q9UNH5-1]
ENST00000361544; ENSP00000354916; ENSG00000079335 [Q9UNH5-2]
ENST00000370124; ENSP00000359142; ENSG00000079335 [Q9UNH5-3]
ENST00000644813; ENSP00000496374; ENSG00000079335 [Q9UNH5-5]
GeneIDi8556
KEGGihsa:8556
UCSCiuc001dte.5 human [Q9UNH5-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
8556
DisGeNETi8556
EuPathDBiHostDB:ENSG00000079335.18

GeneCards: human genes, protein and diseases

More...
GeneCardsi
CDC14A
HGNCiHGNC:1718 CDC14A
HPAiHPA023783
MalaCardsiCDC14A
MIMi603504 gene
608653 phenotype
neXtProtiNX_Q9UNH5
OpenTargetsiENSG00000079335
Orphaneti90636 Autosomal recessive non-syndromic sensorineural deafness type DFNB
PharmGKBiPA26254

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1720 Eukaryota
COG2453 LUCA
GeneTreeiENSGT00940000155899
HOGENOMiHOG000198341
HOVERGENiHBG050818
InParanoidiQ9UNH5
KOiK06639
OMAiYHELNNN
OrthoDBi1357618at2759
PhylomeDBiQ9UNH5
TreeFamiTF101053

Enzyme and pathway databases

ReactomeiR-HSA-176407 Conversion from APC/C:Cdc20 to APC/C:Cdh1 in late anaphase
R-HSA-5687128 MAPK6/MAPK4 signaling
SIGNORiQ9UNH5

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
CDC14A human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
CDC14A

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
8556

Protein Ontology

More...
PROi
PR:Q9UNH5

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000079335 Expressed in 172 organ(s), highest expression level in sperm
ExpressionAtlasiQ9UNH5 baseline and differential
GenevisibleiQ9UNH5 HS

Family and domain databases

Gene3Di3.90.190.10, 2 hits
InterProiView protein in InterPro
IPR029260 DSPn
IPR000340 Dual-sp_phosphatase_cat-dom
IPR026068 Dual_Pase_CDC14A
IPR029021 Prot-tyrosine_phosphatase-like
IPR016130 Tyr_Pase_AS
IPR003595 Tyr_Pase_cat
IPR000387 TYR_PHOSPHATASE_dom
IPR020422 TYR_PHOSPHATASE_DUAL_dom
PANTHERiPTHR23339:SF77 PTHR23339:SF77, 1 hit
PfamiView protein in Pfam
PF00782 DSPc, 1 hit
PF14671 DSPn, 1 hit
SMARTiView protein in SMART
SM00195 DSPc, 1 hit
SM00404 PTPc_motif, 1 hit
SUPFAMiSSF52799 SSF52799, 2 hits
PROSITEiView protein in PROSITE
PS00383 TYR_PHOSPHATASE_1, 1 hit
PS50056 TYR_PHOSPHATASE_2, 1 hit
PS50054 TYR_PHOSPHATASE_DUAL, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCC14A_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9UNH5
Secondary accession number(s): A6MA65
, B1AQ14, B1AQ15, O43171, O60727, O60728, Q52LH9, Q8IXX0
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 23, 2004
Last sequence update: May 1, 2000
Last modified: February 13, 2019
This is version 157 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again