Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Synaptopodin-2

Gene

SYNPO2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Has an actin-binding and actin-bundling activity. Can induce the formation of F-actin networks in an isoform-specific manner (PubMed:24005909, PubMed:23225103). At the sarcomeric Z lines is proposed to act as adapter protein that links nascent myofibers to the sarcolemma via ZYX and may play a role in early assembly and stabilization of the Z lines. Involved in autophagosome formation. May play a role in chaperone-assisted selective autophagy (CASA) involved in Z lines maintenance in striated muscle under mechanical tension; may link the client-processing CASA chaperone machinery to a membrane-tethering and fusion complex providing autophagosome membranes (By similarity). Involved in regulation of cell migration (PubMed:22915763, PubMed:25883213). May be a tumor suppressor (PubMed:16885336).By similarity2 Publications4 Publications
Isoform 1: Involved in regulation of cell migration. Can induce formation of thick, irregular actin bundles in the cell body.2 Publications
Isoform 2: Involved in regulation of cell migration. Can induce long, well-organized actin bundles frequently orientated in parallel along the long axis of the cell showing characteristics of contractile ventral stress fibers.2 Publications
Isoform 3: Involved in regulation of cell migration. Can induce an amorphous actin meshwork throughout the cell body containing a mixture of long and short, randomly organized thick and thin actin bundles.2 Publications
Isoform 4: Can induce long, well-organized actin bundles frequently orientated in parallel along the long axis of the cell showing characteristics of contractile ventral stress fibers.1 Publication
Isoform 5: Involved in regulation of cell migration in part dependent on the Rho-ROCK cascade; can promote formation of nascent focal adhesions, actin bundles at the leading cell edge and lamellipodia (PubMed:22915763, PubMed:25883213). Can induce formation of thick, irregular actin bundles in the cell body; the induced actin network is associated with enhanced cell migration in vitro.3 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • 14-3-3 protein binding Source: UniProtKB
  • actin binding Source: GO_Central
  • alpha-actinin binding Source: UniProtKB
  • filamin binding Source: UniProtKB
  • muscle alpha-actinin binding Source: UniProtKB
  • protein binding, bridging Source: Ensembl

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActin-binding, Muscle protein

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Synaptopodin-2
Alternative name(s):
Genethonin-2
Myopodin
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SYNPO2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 4

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000172403.10

Human Gene Nomenclature Database

More...
HGNCi
HGNC:17732 SYNPO2

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9UMS6

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell junction, Cytoplasm, Cytoskeleton, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Keywords - Diseasei

Tumor suppressor

Organism-specific databases

DisGeNET

More...
DisGeNETi
171024

Open Targets

More...
OpenTargetsi
ENSG00000172403

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA38244

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
SYNPO2

Domain mapping of disease mutations (DMDM)

More...
DMDMi
51702160

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001876731 – 1093Synaptopodin-2Add BLAST1093

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei274PhosphoserineCombined sources1
Modified residuei310PhosphoserineBy similarity1
Modified residuei329PhosphoserineBy similarity1
Modified residuei330PhosphoserineBy similarity1
Modified residuei333PhosphothreonineBy similarity1
Modified residuei548PhosphoserineBy similarity1
Modified residuei549PhosphoserineBy similarity1
Modified residuei551PhosphoserineBy similarity1
Modified residuei604PhosphoserineBy similarity1
Modified residuei610PhosphothreonineCombined sources1
Modified residuei611PhosphoserineCombined sources1
Modified residuei622PhosphotyrosineCombined sources1
Modified residuei626PhosphothreonineCombined sources1
Modified residuei705PhosphoserineBy similarity1
Modified residuei729PhosphoserineCombined sources1
Modified residuei755PhosphothreonineCombined sources1
Modified residuei774PhosphothreonineCombined sources1
Modified residuei777PhosphoserineCombined sources1
Modified residuei781PhosphoserineBy similarity1
Modified residuei902PhosphoserineCombined sources1
Modified residuei906PhosphoserineCombined sources1
Modified residuei910PhosphoserineBy similarity1
Modified residuei1015PhosphoserineBy similarity1
Modified residuei1056PhosphoserineCombined sources1
Isoform 4 (identifier: Q9UMS6-4)
Modified residuei1107PhosphoserineCombined sources1
Isoform 2 (identifier: Q9UMS6-2)
Modified residuei1138PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated by PKA, and by CaMK2 at multiple sites. Dephosphorylated by calcineurin; abrogating interaction with YWHAB and impairing nuclear import (By similarity). Phosphorylated by ILK.By similarity1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9UMS6

PeptideAtlas

More...
PeptideAtlasi
Q9UMS6

PRoteomics IDEntifications database

More...
PRIDEi
Q9UMS6

ProteomicsDB human proteome resource

More...
ProteomicsDBi
85210
85211 [Q9UMS6-2]
85212 [Q9UMS6-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9UMS6

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9UMS6

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in heart muscle. Isoform 5 is specifically expressed in skeletal muscle.2 Publications

<p>This subsection of the ‘Expression’ section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified ‘at the protein level’.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Detected in myoblasts within 24 h after induction of myogenic differentiation preceeding the expression of sarcomeric alpha-actinin. Specifically at early stages colocalizes with ZYX at focal adhesions.1 Publication

<p>This subsection of the ‘Expression’ section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Down-regulated in muscle cell lines derived from patients with Duchenne muscular dystrophy (DMD).1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000172403 Expressed in 208 organ(s), highest expression level in cauda epididymis

CleanEx database of gene expression profiles

More...
CleanExi
HS_SYNPO2

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9UMS6 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9UMS6 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB037231
HPA030665
HPA049707
HPA068563

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

May self-associate in muscle cells under oxidative stress. Binds F-actin (PubMed:23225103). Interacts with ACTN2; ACTN2 is proposed to anchor SYOP2 at Z lines in mature myocytes (PubMed:20554076). Interacts with AKAP6, PPP3CA and CAMK2A. Interacts (phosphorylated form) with YWHAB; YWHAB competes with ACTN2 for interaction with SYNPO2. Interacts with KPNA2; mediating nuclear import of SYNOP2; dependent on interaction with YWHAB (By similarity). Interacts with IPO13; may be implicated in SYNOP2 nuclear import (PubMed:17828378). Interacts with ZYX, FLNC, ILK (PubMed:16885336, PubMed:20554076, PubMed:21643011). Interacts with BAG3 (via WW 1 domain). May associate with the CASA complex consisting of HSPA8, HSPB8 and BAG3. Interacts with VPS18 (PubMed:23434281).By similarity5 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
ILKQ134186EBI-3453434,EBI-747644

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
128105, 20 interactors

Database of interacting proteins

More...
DIPi
DIP-47311N

Protein interaction database and analysis system

More...
IntActi
Q9UMS6, 7 interactors

Molecular INTeraction database

More...
MINTi
Q9UMS6

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000306015

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q9UMS6

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9UMS6

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini6 – 88PDZPROSITE-ProRule annotationAdd BLAST83

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 180Interaction with VPS181 PublicationAdd BLAST180
Regioni481 – 663Interaction with ACTN21 PublicationAdd BLAST183
Regioni534 – 663F-actin binding1 PublicationAdd BLAST130
Regioni607 – 811Interaction with YWHABBy similarityAdd BLAST205
Regioni615 – 626Interaction with BAG31 PublicationAdd BLAST12
Regioni664 – 924Interaction with ACTN21 PublicationAdd BLAST261
Regioni664 – 916F-actin bundling activity1 PublicationAdd BLAST253
Regioni664 – 803F-actin binding1 PublicationAdd BLAST140
Regioni751 – 900Actin bindingBy similarityAdd BLAST150
Regioni810 – 1093Interaction with FLNC1 PublicationAdd BLAST284
Regioni901 – 1093Interaction with ACTN21 PublicationAdd BLAST193
Regioni1000 – 1019Interaction with ZYX1 PublicationAdd BLAST20

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi398 – 406Nuclear localization signalBy similarity9
Motifi619 – 622PPPY motif1 Publication4

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi400 – 405Poly-Arg6
Compositional biasi423 – 426Poly-Glu4
Compositional biasi591 – 658Pro-richAdd BLAST68
Compositional biasi756 – 818Pro-richAdd BLAST63
Compositional biasi767 – 770Poly-Ser4

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The PPPY motif interacts with the WW domain 1 of BAG3.1 Publication

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the synaptopodin family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IIQE Eukaryota
ENOG410ZJ02 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000159337

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000261625

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG079226

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9UMS6

Identification of Orthologs from Complete Genome Data

More...
OMAi
RSDYCLS

Database of Orthologous Groups

More...
OrthoDBi
EOG091G01MS

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9UMS6

TreeFam database of animal gene trees

More...
TreeFami
TF330867

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR001478 PDZ
IPR036034 PDZ_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00595 PDZ, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00228 PDZ, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF50156 SSF50156, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50106 PDZ, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative promoter usage and alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9UMS6-1) [UniParc]FASTAAdd to basket
Also known as: Myo1, SYNOPb, Synop2A

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGTGDFICIS MTGGAPWGFR LQGGKEQKQP LQVAKIRNQS KASGSGLCEG
60 70 80 90 100
DEVVSINGNP CADLTYPEVI KLMESITDSL QMLIKRPSSG ISEALISENE
110 120 130 140 150
NKNLEHLTHG GYVESTTLQI RPATKTQCTE FFLAPVKTEV PLAENQRSGP
160 170 180 190 200
DCAGSLKEET GPSYQRAPQM PDSQRGRVAE ELILREKVEA VQPGPVVELQ
210 220 230 240 250
LSLSQERHKG ASGPLVALPG AEKSKSPDPD PNLSHDRIVH INSIPTNEKA
260 270 280 290 300
DPFLRSSKII QISSGRELRV IQESEAGDAG LPRVEVILDC SDRQKTEGCR
310 320 330 340 350
LQAGKECVDS PVEGGQSEAP PSLVSFAVSS EGTEQGEDPR SEKDHSRPHK
360 370 380 390 400
HRARHARLRR SESLSEKQVK EAKSKCKSIA LLLTDAPNPN SKGVLMFKKR
410 420 430 440 450
RRRARKYTLV SYGTGELERE ADEEEEGDKE DTCEVAFLGA SESEVDEELL
460 470 480 490 500
SDVDDNTQVV NFDWDSGLVD IEKKLNRGDK MEMLPDTTGK GALMFAKRRE
510 520 530 540 550
RMDQITAQKE EDKVGGTPSR EQDAAQTDGL RTTTSYQRKE EESVRTQSSV
560 570 580 590 600
SKSYIEVSHG LGHVPQQNGF SGTSETANIQ RMVPMNRTAK PFPGSVNQPA
610 620 630 640 650
TPFSPTRNMT SPIADFPAPP PYSAVTPPPD AFSRGVSSPI AGPAQPPPWP
660 670 680 690 700
QPAPWSQPAF YDSSERIASR DERISVPAKR TGILQEAKRR STTKPMFTFK
710 720 730 740 750
EPKVSPNPEL LSLLQNSEGK RGTGAGGDSG PEEDYLSLGA EACNFMQSSS
760 770 780 790 800
AKQKTPPPVA PKPAVKSSSS QPVTPVSPVW SPGVAPTQPP AFPTSNPSKG
810 820 830 840 850
TVVSSIKIAQ PSYPPARPAS TLNVAGPFKG PQAAVASQNY TPKPTVSTPT
860 870 880 890 900
VNAVQPGAVG PSNELPGMSG RGAQLFAKRQ SRMEKYVVDS DTVQAHAARA
910 920 930 940 950
QSPTPSLPAS WKYSSNVRAP PPVAYNPIHS PSYPLAALKS QPSAAQPSKM
960 970 980 990 1000
GKKKGKKPLN ALDVMKHQPY QLNASLFTFQ PPDAKDGLPQ KSSVKVNSAL
1010 1020 1030 1040 1050
AMKQALPPRP VNAASPTNVQ ASSVYSVPAY TSPPSFFAEA SSPVSASPVP
1060 1070 1080 1090
VGIPTSPKQE SASSSYFVAP RPKFSAKKSG VTIQVWKPSV VEE
Note: Produced by alternative promoter usage.
Length:1,093
Mass (Da):117,514
Last modified:August 31, 2004 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i8DF6F4D2823B444D
GO
Isoform 2 (identifier: Q9UMS6-2) [UniParc]FASTAAdd to basket
Also known as: Myo3, SYNOPa, Synop2C

The sequence of this isoform differs from the canonical sequence as follows:
     1085-1093: VWKPSVVEE → ESGRSLSLPG...PHPRGWRRQT

Note: =Produced by alternative splicing of isoform 1.Combined sources
Show »
Length:1,261
Mass (Da):136,342
Checksum:iE38B72200E742404
GO
Isoform 3 (identifier: Q9UMS6-3) [UniParc]FASTAAdd to basket
Also known as: Myo2, SYNOPc, Synop2B

The sequence of this isoform differs from the canonical sequence as follows:
     1086-1093: WKPSVVEE → KCKSGIHSQDIIRTYFPAYLSSST

Note: =Produced by alternative splicing of isoform 1.
Show »
Length:1,109
Mass (Da):119,244
Checksum:i1AECA76771126803
GO
Isoform 4 (identifier: Q9UMS6-4) [UniParc]FASTAAdd to basket
Also known as: Myo4, Synop2D

The sequence of this isoform differs from the canonical sequence as follows:
     1-35: MGTGDFICISMTGGAPWGFRLQGGKEQKQPLQVAK → MVTQ
     1085-1093: VWKPSVVEE → ESGRSLSLPG...PHPRGWRRQT

Note: =Produced by alternative splicing of isoform 1.Combined sources
Show »
Length:1,230
Mass (Da):133,081
Checksum:iC54DF3CE60B6BAEE
GO
Isoform 5 (identifier: Q9UMS6-5) [UniParc]FASTAAdd to basket
Also known as: (delta)N-MYO1, SYNOPd, SYNOP2As

The sequence of this isoform differs from the canonical sequence as follows:
     1-395: Missing.

Note: Produced by alternative promoter usage.1 Publication
Show »
Length:698
Mass (Da):74,762
Checksum:i19E5AE7E74491FB6
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0Y9Y3H0Y9Y3_HUMAN
Synaptopodin-2
SYNPO2
1,155Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B4E258B4E258_HUMAN
cDNA FLJ52650, moderately similar t...
SYNPO2
123Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti61C → R in AL832031 (PubMed:17974005).Curated1
Sequence conflicti147Missing in AL832031 (PubMed:17974005).Curated1
Sequence conflicti263 – 266SSGR → IRHE in CAB51856 (PubMed:11673475).Curated4
Sequence conflicti508Q → P in AGS94404 (PubMed:24005909).Curated1
Sequence conflicti667I → M in AL832031 (PubMed:17974005).Curated1
Sequence conflicti969P → L in AAI50630 (PubMed:15489334).Curated1
Sequence conflicti987G → V in AAI50630 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_057256154G → A1 PublicationCorresponds to variant dbSNP:rs12645298Ensembl.1
Natural variantiVAR_057257174Q → H. Corresponds to variant dbSNP:rs17263971Ensembl.1
Natural variantiVAR_057258179A → T. Corresponds to variant dbSNP:rs17050152Ensembl.1
Natural variantiVAR_019670573T → A6 PublicationsCorresponds to variant dbSNP:rs7698598Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0588871 – 395Missing in isoform 5. Add BLAST395
Alternative sequenceiVSP_0537711 – 35MGTGD…LQVAK → MVTQ in isoform 4. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_0412221085 – 1093VWKPSVVEE → ESGRSLSLPGRSVPPPISTS PWVYQPTYSYSSKPTDGLEK ANKRPTPWEAAAKSPLGLVD DAFQPRNIQESIVANVVSAA RRKVLPGPPEDWNERLSYIP QTQKAYMGSCGRQEYNVTAN NNMSTTSQYGSQLPYAYYRQ ASRNDSAIMSMETRSDYCLP VADYNYNPHPRGWRRQT in isoform 2 and isoform 4. 2 Publications9
Alternative sequenceiVSP_0412231086 – 1093WKPSVVEE → KCKSGIHSQDIIRTYFPAYL SSST in isoform 3. 1 Publication8

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
EU481975 mRNA Translation: ACC93875.1
KF147165 mRNA Translation: AGS94404.1
AL832031 mRNA No translation available.
AL833294 mRNA No translation available.
AC096745 Genomic DNA No translation available.
AC107048 Genomic DNA No translation available.
AC108030 Genomic DNA No translation available.
CH471229 Genomic DNA Translation: EAW73659.1
FN422000 mRNA Translation: CAZ66141.1
BC150629 mRNA Translation: AAI50630.1
AJ010482 mRNA Translation: CAB51856.1
AF177291 mRNA Translation: AAD55264.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS34054.1 [Q9UMS6-2]
CCDS47128.1 [Q9UMS6-3]
CCDS47129.1 [Q9UMS6-1]
CCDS75185.1 [Q9UMS6-4]

NCBI Reference Sequences

More...
RefSeqi
NP_001122405.1, NM_001128933.2 [Q9UMS6-1]
NP_001122406.1, NM_001128934.2 [Q9UMS6-3]
NP_001273683.1, NM_001286754.1 [Q9UMS6-4]
NP_597734.2, NM_133477.2 [Q9UMS6-2]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.655519

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000307142; ENSP00000306015; ENSG00000172403 [Q9UMS6-2]
ENST00000429713; ENSP00000395143; ENSG00000172403 [Q9UMS6-1]
ENST00000434046; ENSP00000390965; ENSG00000172403 [Q9UMS6-3]
ENST00000610556; ENSP00000484885; ENSG00000172403 [Q9UMS6-4]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
171024

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:171024

UCSC genome browser

More...
UCSCi
uc003icm.6 human [Q9UMS6-1]

Keywords - Coding sequence diversityi

Alternative promoter usage, Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
EU481975 mRNA Translation: ACC93875.1
KF147165 mRNA Translation: AGS94404.1
AL832031 mRNA No translation available.
AL833294 mRNA No translation available.
AC096745 Genomic DNA No translation available.
AC107048 Genomic DNA No translation available.
AC108030 Genomic DNA No translation available.
CH471229 Genomic DNA Translation: EAW73659.1
FN422000 mRNA Translation: CAZ66141.1
BC150629 mRNA Translation: AAI50630.1
AJ010482 mRNA Translation: CAB51856.1
AF177291 mRNA Translation: AAD55264.1
CCDSiCCDS34054.1 [Q9UMS6-2]
CCDS47128.1 [Q9UMS6-3]
CCDS47129.1 [Q9UMS6-1]
CCDS75185.1 [Q9UMS6-4]
RefSeqiNP_001122405.1, NM_001128933.2 [Q9UMS6-1]
NP_001122406.1, NM_001128934.2 [Q9UMS6-3]
NP_001273683.1, NM_001286754.1 [Q9UMS6-4]
NP_597734.2, NM_133477.2 [Q9UMS6-2]
UniGeneiHs.655519

3D structure databases

ProteinModelPortaliQ9UMS6
SMRiQ9UMS6
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi128105, 20 interactors
DIPiDIP-47311N
IntActiQ9UMS6, 7 interactors
MINTiQ9UMS6
STRINGi9606.ENSP00000306015

PTM databases

iPTMnetiQ9UMS6
PhosphoSitePlusiQ9UMS6

Polymorphism and mutation databases

BioMutaiSYNPO2
DMDMi51702160

Proteomic databases

PaxDbiQ9UMS6
PeptideAtlasiQ9UMS6
PRIDEiQ9UMS6
ProteomicsDBi85210
85211 [Q9UMS6-2]
85212 [Q9UMS6-3]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
171024
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000307142; ENSP00000306015; ENSG00000172403 [Q9UMS6-2]
ENST00000429713; ENSP00000395143; ENSG00000172403 [Q9UMS6-1]
ENST00000434046; ENSP00000390965; ENSG00000172403 [Q9UMS6-3]
ENST00000610556; ENSP00000484885; ENSG00000172403 [Q9UMS6-4]
GeneIDi171024
KEGGihsa:171024
UCSCiuc003icm.6 human [Q9UMS6-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
171024
DisGeNETi171024
EuPathDBiHostDB:ENSG00000172403.10

GeneCards: human genes, protein and diseases

More...
GeneCardsi
SYNPO2
HGNCiHGNC:17732 SYNPO2
HPAiCAB037231
HPA030665
HPA049707
HPA068563
neXtProtiNX_Q9UMS6
OpenTargetsiENSG00000172403
PharmGKBiPA38244

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IIQE Eukaryota
ENOG410ZJ02 LUCA
GeneTreeiENSGT00940000159337
HOGENOMiHOG000261625
HOVERGENiHBG079226
InParanoidiQ9UMS6
OMAiRSDYCLS
OrthoDBiEOG091G01MS
PhylomeDBiQ9UMS6
TreeFamiTF330867

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
SYNPO2 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
SYNPO2

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
171024

Protein Ontology

More...
PROi
PR:Q9UMS6

Gene expression databases

BgeeiENSG00000172403 Expressed in 208 organ(s), highest expression level in cauda epididymis
CleanExiHS_SYNPO2
ExpressionAtlasiQ9UMS6 baseline and differential
GenevisibleiQ9UMS6 HS

Family and domain databases

InterProiView protein in InterPro
IPR001478 PDZ
IPR036034 PDZ_sf
PfamiView protein in Pfam
PF00595 PDZ, 1 hit
SMARTiView protein in SMART
SM00228 PDZ, 1 hit
SUPFAMiSSF50156 SSF50156, 1 hit
PROSITEiView protein in PROSITE
PS50106 PDZ, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSYNP2_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9UMS6
Secondary accession number(s): B2RWP6
, B2Y8J9, C6H0M7, Q9UK89, S5XAM4
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 31, 2004
Last sequence update: August 31, 2004
Last modified: December 5, 2018
This is version 146 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again