Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

C-type lectin domain family 4 member A

Gene

CLEC4A

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

C-type lectin receptor that binds carbohydrates mannose and fucose but also weakly interacts with N-acetylglucosamine (GlcNAc) in a Ca2+-dependent manner (PubMed:27015765). Involved in regulating immune reactivity (PubMed:18258799, PubMed:10438934). Once triggered by antigen, it is internalized by clathrin-dependent endocytosis and delivers its antigenic cargo into the antigen presentation pathway resulting in cross-priming of CD8+ T cells. This cross-presentation and cross-priming are enhanced by TLR7 and TLR8 agonists with increased expansion of the CD8+ T cells, high production of IFNG and TNF with reduced levels of IL4, IL5 and IL13 (PubMed:18258799, PubMed:20530286). In plasmacytoid dendritic cells, inhibits TLR9-mediated IFNA and TNF production (PubMed:18258799). May be involved via its ITIM motif (immunoreceptor tyrosine-based inhibitory motifs) in the inhibition of B-cell-receptor-mediated calcium mobilization and protein tyrosine phosphorylation (PubMed:10438934).4 Publications
(Microbial infection) Involved in the interaction between HIV-1 virus and dendritic cells. Enhances HIV-1 binding/entry and virus infection. Requires ITIM motif-associated signal transduction pathway involving phosphatases PTPN6 and PTPN11, SYK, Src kinases and MAP kinases.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the ‘Description’ field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi143Calcium 1; via carbonyl oxygenCombined sources1 Publication1
Metal bindingi145Calcium 1Combined sources1 Publication1
Metal bindingi149Calcium 1Combined sources1 Publication1
Metal bindingi195Calcium 2Combined sources1 Publication1
Metal bindingi197Calcium 2Combined sources1 Publication1
Metal bindingi201Calcium 2Combined sources1 Publication1
<p>This subsection of the ‘Function’ section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei201MannoseCombined sources1 Publication1
Metal bindingi218Calcium 2Combined sources1 Publication1
Metal bindingi219Calcium 2Combined sources1 Publication1
Metal bindingi231Calcium 1Combined sources1 Publication1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • calcium ion binding Source: UniProtKB
  • carbohydrate binding Source: UniProtKB
  • mannose binding Source: UniProtKB
  • transmembrane signaling receptor activity Source: ProtInc

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processAdaptive immunity, Immunity, Innate immunity
LigandCalcium, Lectin, Metal-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-5621480 Dectin-2 family

Protein family/group databases

UniLectin database of carbohydrate-binding proteins

More...
UniLectini
Q9UMR7

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
C-type lectin domain family 4 member ACurated
Alternative name(s):
C-type lectin DDB27
C-type lectin superfamily member 6
Dendritic cell immunoreceptor
Lectin-like immunoreceptor
CD_antigen: CD367
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CLEC4AImported
Synonyms:CLECSF61 Publication, DCIR1 Publication, LLIR
ORF Names:HDCGC13P
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 12

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000111729.12

Human Gene Nomenclature Database

More...
HGNCi
HGNC:13257 CLEC4A

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
605306 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9UMR7

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 48CytoplasmicSequence analysisAdd BLAST48
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei49 – 69Helical; Signal-anchor for type II membrane proteinSequence analysisAdd BLAST21
Topological domaini70 – 237ExtracellularSequence analysisAdd BLAST168

Keywords - Cellular componenti

Cell membrane, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi6T → F: Decreases HIV-1 binding/entry in cells as well as virus replication. 1 Publication1
Mutagenesisi7Y → F: Decreases HIV-1 binding/entry in cells as well as virus replication. 1 Publication1

Organism-specific databases

DisGeNET

More...
DisGeNETi
50856

Open Targets

More...
OpenTargetsi
ENSG00000111729

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA26584

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
CLEC4A

Domain mapping of disease mutations (DMDM)

More...
DMDMi
59797977

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000466121 – 237C-type lectin domain family 4 member AAdd BLAST237

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi106 ↔ 117PROSITE-ProRule annotationCombined sources1 Publication
Disulfide bondi134 ↔ 230PROSITE-ProRule annotationCombined sources1 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi185N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi203 ↔ 222PROSITE-ProRule annotationCombined sources1 Publication

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9UMR7

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9UMR7

PeptideAtlas

More...
PeptideAtlasi
Q9UMR7

PRoteomics IDEntifications database

More...
PRIDEi
Q9UMR7

ProteomicsDB human proteome resource

More...
ProteomicsDBi
85200
85201 [Q9UMR7-2]
85202 [Q9UMR7-3]
85203 [Q9UMR7-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9UMR7

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9UMR7

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed preferentially in hematopoietic tissues. Expressed in all circulating Ag-presenting cells such as dendritic cells, myeloid cells, monocytes, macrophages, B-cells and epidermal Langerhans cells (at protein level). Expressed in peripheral blood leukocytes, neutrophils, moderate quantities in spleen, lymph node, and bone marrow, and at very low levels in thymus.5 Publications

<p>This subsection of the ‘Expression’ section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

TNF alpha, IL-1 alpha, and LPS, down-regulated expression at the surface of neutrophils (at protein level) (PubMed:11994513). Expression is decreased in dendritic cells by signals inducing their maturation (e.g. CD40 ligand, TLR9 ligands, LPS, and TNF alpha) (PubMed:10438934, PubMed:18258799). Isoform 2: mRNA expression is up-regulated by agonists of neutrophils CSF2/GM-CSF, IL3/interleukin-3, IL4/interleukin-4 and IL13/interleukin-13 (PubMed:11994513).3 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000111729 Expressed in 177 organ(s), highest expression level in bone marrow

CleanEx database of gene expression profiles

More...
CleanExi
HS_CLEC4A

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9UMR7 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9UMR7 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA007842

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

May interact with PTPN6 via its ITIM motif.

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
119158, 53 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000229332

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1237
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
5B1WX-ray3.05A/B/C/D106-237[»]
5B1XX-ray2.90A/B/C/D106-237[»]

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q9UMR7

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9UMR7

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini113 – 231C-type lectinPROSITE-ProRule annotationAdd BLAST119

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni195 – 197Mannose bindingCombined sources1 Publication3
Regioni207 – 209N-acetyl-D-glucosamine bindingCombined sources1 Publication3

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi5 – 10ITIM motif1 Publication6

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

Keywords - Domaini

Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG4297 Eukaryota
ENOG410XPJ1 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000158835

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000059556

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG050992

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9UMR7

KEGG Orthology (KO)

More...
KOi
K10057

Identification of Orthologs from Complete Genome Data

More...
OMAi
APHKSNT

Database of Orthologous Groups

More...
OrthoDBi
1378771at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9UMR7

TreeFam database of animal gene trees

More...
TreeFami
TF333341

Family and domain databases

Conserved Domains Database

More...
CDDi
cd03590 CLECT_DC-SIGN_like, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.10.100.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR001304 C-type_lectin-like
IPR016186 C-type_lectin-like/link_sf
IPR018378 C-type_lectin_CS
IPR033989 CD209-like_CTLD
IPR016187 CTDL_fold

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00059 Lectin_C, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00034 CLECT, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF56436 SSF56436, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00615 C_TYPE_LECTIN_1, 1 hit
PS50041 C_TYPE_LECTIN_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9UMR7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MTSEITYAEV RFKNEFKSSG INTASSAASK ERTAPHKSNT GFPKLLCASL
60 70 80 90 100
LIFFLLLAIS FFIAFVIFFQ KYSQLLEKKT TKELVHTTLE CVKKNMPVEE
110 120 130 140 150
TAWSCCPKNW KSFSSNCYFI STESASWQDS EKDCARMEAH LLVINTQEEQ
160 170 180 190 200
DFIFQNLQEE SAYFVGLSDP EGQRHWQWVD QTPYNESSTF WHPREPSDPN
210 220 230
ERCVVLNFRK SPKRWGWNDV NCLGPQRSVC EMMKIHL
Length:237
Mass (Da):27,512
Last modified:May 1, 2000 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i1D07003E4C9CF96E
GO
Isoform 2 (identifier: Q9UMR7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     67-100: IFFQKYSQLLEKKTTKELVHTTLECVKKNMPVEE → K

Show »
Length:204
Mass (Da):23,575
Checksum:i52107ED59D9AEFE0
GO
Isoform 3 (identifier: Q9UMR7-3) [UniParc]FASTAAdd to basket
Also known as: llirV1

The sequence of this isoform differs from the canonical sequence as follows:
     28-67: ASKERTAPHKSNTGFPKLLCASLLIFFLLLAISFFIAFVI → V

Show »
Length:198
Mass (Da):23,203
Checksum:iD165142F9DA7EE85
GO
Isoform 4 (identifier: Q9UMR7-4) [UniParc]FASTAAdd to basket
Also known as: llirV2

The sequence of this isoform differs from the canonical sequence as follows:
     28-99: Missing.

Show »
Length:165
Mass (Da):19,280
Checksum:iE5CB43A6D3437B67
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A286YF15A0A286YF15_HUMAN
C-type lectin domain family 4 membe...
CLEC4A
84Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAL56016 differs from that shown. Reason: Frameshift at position 229.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti130S → C in AAF75560 (PubMed:16541075).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_02126036H → L3 PublicationsCorresponds to variant dbSNP:rs2024301Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_01284228 – 99Missing in isoform 4. 1 PublicationAdd BLAST72
Alternative sequenceiVSP_04134828 – 67ASKER…IAFVI → V in isoform 3. 1 PublicationAdd BLAST40
Alternative sequenceiVSP_01284467 – 100IFFQK…MPVEE → K in isoform 2. 1 PublicationAdd BLAST34

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AJ133532 mRNA Translation: CAB54001.1
AF067800 mRNA Translation: AAF75560.1
AF328684 mRNA Translation: AAL56016.1 Frameshift.
AF109146 mRNA Translation: AAF14348.1
AF200738 mRNA Translation: AAG35593.1
AC006511 Genomic DNA No translation available.
AC092111 Genomic DNA No translation available.
BC074822 mRNA Translation: AAH74822.1
BC074874 mRNA Translation: AAH74874.1
BC117439 mRNA Translation: AAI17440.1
BC117441 mRNA Translation: AAI17442.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS41745.1 [Q9UMR7-3]
CCDS8590.1 [Q9UMR7-1]
CCDS8591.1 [Q9UMR7-4]
CCDS8592.1 [Q9UMR7-2]

Protein sequence database of the Protein Information Resource

More...
PIRi
JC7608

NCBI Reference Sequences

More...
RefSeqi
NP_057268.1, NM_016184.3 [Q9UMR7-1]
NP_919429.2, NM_194447.2 [Q9UMR7-3]
NP_919430.1, NM_194448.2 [Q9UMR7-4]
NP_919432.1, NM_194450.2 [Q9UMR7-2]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.504657

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000229332; ENSP00000229332; ENSG00000111729 [Q9UMR7-1]
ENST00000345999; ENSP00000344646; ENSG00000111729 [Q9UMR7-4]
ENST00000352620; ENSP00000247243; ENSG00000111729 [Q9UMR7-2]
ENST00000360500; ENSP00000353690; ENSG00000111729 [Q9UMR7-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
50856

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:50856

UCSC genome browser

More...
UCSCi
uc001qtz.1 human [Q9UMR7-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Functional Glycomics Gateway - Glycan Binding

DCIR

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ133532 mRNA Translation: CAB54001.1
AF067800 mRNA Translation: AAF75560.1
AF328684 mRNA Translation: AAL56016.1 Frameshift.
AF109146 mRNA Translation: AAF14348.1
AF200738 mRNA Translation: AAG35593.1
AC006511 Genomic DNA No translation available.
AC092111 Genomic DNA No translation available.
BC074822 mRNA Translation: AAH74822.1
BC074874 mRNA Translation: AAH74874.1
BC117439 mRNA Translation: AAI17440.1
BC117441 mRNA Translation: AAI17442.1
CCDSiCCDS41745.1 [Q9UMR7-3]
CCDS8590.1 [Q9UMR7-1]
CCDS8591.1 [Q9UMR7-4]
CCDS8592.1 [Q9UMR7-2]
PIRiJC7608
RefSeqiNP_057268.1, NM_016184.3 [Q9UMR7-1]
NP_919429.2, NM_194447.2 [Q9UMR7-3]
NP_919430.1, NM_194448.2 [Q9UMR7-4]
NP_919432.1, NM_194450.2 [Q9UMR7-2]
UniGeneiHs.504657

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
5B1WX-ray3.05A/B/C/D106-237[»]
5B1XX-ray2.90A/B/C/D106-237[»]
ProteinModelPortaliQ9UMR7
SMRiQ9UMR7
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi119158, 53 interactors
STRINGi9606.ENSP00000229332

Protein family/group databases

UniLectiniQ9UMR7

PTM databases

iPTMnetiQ9UMR7
PhosphoSitePlusiQ9UMR7

Polymorphism and mutation databases

BioMutaiCLEC4A
DMDMi59797977

Proteomic databases

jPOSTiQ9UMR7
PaxDbiQ9UMR7
PeptideAtlasiQ9UMR7
PRIDEiQ9UMR7
ProteomicsDBi85200
85201 [Q9UMR7-2]
85202 [Q9UMR7-3]
85203 [Q9UMR7-4]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000229332; ENSP00000229332; ENSG00000111729 [Q9UMR7-1]
ENST00000345999; ENSP00000344646; ENSG00000111729 [Q9UMR7-4]
ENST00000352620; ENSP00000247243; ENSG00000111729 [Q9UMR7-2]
ENST00000360500; ENSP00000353690; ENSG00000111729 [Q9UMR7-3]
GeneIDi50856
KEGGihsa:50856
UCSCiuc001qtz.1 human [Q9UMR7-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
50856
DisGeNETi50856
EuPathDBiHostDB:ENSG00000111729.12

GeneCards: human genes, protein and diseases

More...
GeneCardsi
CLEC4A
HGNCiHGNC:13257 CLEC4A
HPAiHPA007842
MIMi605306 gene
neXtProtiNX_Q9UMR7
OpenTargetsiENSG00000111729
PharmGKBiPA26584

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG4297 Eukaryota
ENOG410XPJ1 LUCA
GeneTreeiENSGT00940000158835
HOGENOMiHOG000059556
HOVERGENiHBG050992
InParanoidiQ9UMR7
KOiK10057
OMAiAPHKSNT
OrthoDBi1378771at2759
PhylomeDBiQ9UMR7
TreeFamiTF333341

Enzyme and pathway databases

ReactomeiR-HSA-5621480 Dectin-2 family

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
CLEC4A human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
CLEC4A

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
50856

Protein Ontology

More...
PROi
PR:Q9UMR7

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000111729 Expressed in 177 organ(s), highest expression level in bone marrow
CleanExiHS_CLEC4A
ExpressionAtlasiQ9UMR7 baseline and differential
GenevisibleiQ9UMR7 HS

Family and domain databases

CDDicd03590 CLECT_DC-SIGN_like, 1 hit
Gene3Di3.10.100.10, 1 hit
InterProiView protein in InterPro
IPR001304 C-type_lectin-like
IPR016186 C-type_lectin-like/link_sf
IPR018378 C-type_lectin_CS
IPR033989 CD209-like_CTLD
IPR016187 CTDL_fold
PfamiView protein in Pfam
PF00059 Lectin_C, 1 hit
SMARTiView protein in SMART
SM00034 CLECT, 1 hit
SUPFAMiSSF56436 SSF56436, 1 hit
PROSITEiView protein in PROSITE
PS00615 C_TYPE_LECTIN_1, 1 hit
PS50041 C_TYPE_LECTIN_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCLC4A_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9UMR7
Secondary accession number(s): Q17R69
, Q8WXW9, Q9H2Z9, Q9NS33, Q9UI34
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 15, 2005
Last sequence update: May 1, 2000
Last modified: January 16, 2019
This is version 154 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human cell differentiation molecules
    CD nomenclature of surface proteins of human leucocytes and list of entries
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again