Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

TP53-target gene 3 protein

Gene

TP53TG3

more
Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May play a significant role in p53/TP53-mediating signaling pathway.1 Publication

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
TP53-target gene 3 protein
Alternative name(s):
TP53-inducible gene 3 protein
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:TP53TG3Imported
Synonyms:TP53TG3A
AND
Name:TP53TG3BImported
AND
Name:TP53TG3CImported
AND
Name:TP53TG3DImported
AND
Name:TP53TG3EImported
AND
Name:TP53TG3FImported
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 16

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000183632.14
HostDB:ENSG00000205456.11
HostDB:ENSG00000205457.10
HostDB:ENSG00000261509.6

Human Gene Nomenclature Database

More...
HGNCi
HGNC:30759 TP53TG3
HGNC:37202 TP53TG3B
HGNC:42962 TP53TG3C
HGNC:44657 TP53TG3D
HGNC:51816 TP53TG3E
HGNC:51817 TP53TG3F

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
617482 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9ULZ0

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000183632
ENSG00000205456
ENSG00000205457

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA165450804

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
TP53TG3

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003289831 – 132TP53-target gene 3 proteinAdd BLAST132

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9ULZ0

PRoteomics IDEntifications database

More...
PRIDEi
Q9ULZ0

ProteomicsDB human proteome resource

More...
ProteomicsDBi
85153
85154 [Q9ULZ0-2]
85155 [Q9ULZ0-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9ULZ0

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9ULZ0

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Strongly expressed in testis. Weakly expressed in heart, placenta and skeletal muscle.1 Publication

<p>This subsection of the ‘Expression’ section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

By p53/TP53.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000183632 Expressed in 55 organ(s), highest expression level in right testis

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9ULZ0 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9ULZ0 HS

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
117300, 1 interactor

Protein interaction database and analysis system

More...
IntActi
Q9ULZ0, 1 interactor

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q9ULZ0

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410KCDV Eukaryota
ENOG4110P2I LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000001729

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000154671

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9ULZ0

Identification of Orthologs from Complete Genome Data

More...
OMAi
CREEPCC

Database of Orthologous Groups

More...
OrthoDBi
EOG09371IB9

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9ULZ0

TreeFam database of animal gene trees

More...
TreeFami
TF342471

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9ULZ0-1) [UniParc]FASTAAdd to basket
Also known as: TP53TG3b

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MRASPCISQP AASWHPRPSA LRPTAGSGPD TRTPGTVEDG SAPCPAFRSP
60 70 80 90 100
AVSPCGEEPC CFQISPAEET LELGRLVSPG NCDTLSPRAA GFYACHVRSL
110 120 130
IPCRSTKGRW PLTASAAGLS RHAQCGPSLG LG
Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.Curated
Length:132
Mass (Da):13,627
Last modified:May 1, 2000 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i7158291F424405A8
GO
Isoform 2 (identifier: Q9ULZ0-2) [UniParc]FASTAAdd to basket
Also known as: TP53TG3a

The sequence of this isoform differs from the canonical sequence as follows:
     121-132: RHAQCGPSLGLG → SFSG

Show »
Length:124
Mass (Da):12,828
Checksum:iFD05DF7A8D1E79AE
GO
Isoform 3 (identifier: Q9ULZ0-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     81-132: NCDTLSPRAAGFYACHVRSLIPCRSTKGRWPLTASAAGLSRHAQCGPSLGLG → CHKSSAPQERRLDPRARCVVHI

Show »
Length:102
Mass (Da):10,773
Checksum:iFBEECC55159EB007
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A1Y8EMM2A0A1Y8EMM2_HUMAN
TP53-target gene 3 protein
TP53TG3D TP53TG3B
7Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
I3L219I3L219_HUMAN
TP53-target gene 3 protein
TP53TG3
142Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BT92H3BT92_HUMAN
TP53-target gene 3 protein
TP53TG3D
102Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_03287081 – 132NCDTL…SLGLG → CHKSSAPQERRLDPRARCVV HI in isoform 3. 1 PublicationAdd BLAST52
Alternative sequenceiVSP_032871121 – 132RHAQC…SLGLG → SFSG in isoform 2. 3 PublicationsAdd BLAST12

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB023508 mRNA Translation: BAA84978.1
AB023509 mRNA Translation: BAA84979.1
CR541650 mRNA Translation: CAG46451.1
AK312220 mRNA Translation: BAG35153.1
AL133588 mRNA Translation: CAH10710.1
BC096700 mRNA Translation: AAH96700.1
BC096733 mRNA Translation: AAH96733.1
BC098165 mRNA Translation: AAH98165.1
BC099842 mRNA Translation: AAH99842.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS45475.1 [Q9ULZ0-2]
CCDS45477.1 [Q9ULZ0-2]
CCDS58456.1 [Q9ULZ0-2]
CCDS58458.1 [Q9ULZ0-2]
CCDS81974.1 [Q9ULZ0-2]
CCDS81976.1 [Q9ULZ0-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001093157.1, NM_001099687.3 [Q9ULZ0-2]
NP_001192188.1, NM_001205259.2 [Q9ULZ0-2]
NP_001230651.1, NM_001243722.2 [Q9ULZ0-2]
NP_001316990.1, NM_001330061.1 [Q9ULZ0-2]
NP_001316995.1, NM_001330066.1 [Q9ULZ0-2]
NP_057296.1, NM_016212.4 [Q9ULZ0-2]
XP_006721089.1, XM_006721026.1 [Q9ULZ0-1]
XP_006721137.1, XM_006721074.2 [Q9ULZ0-1]
XP_006721147.1, XM_006721084.1 [Q9ULZ0-1]
XP_006721180.1, XM_006721117.2 [Q9ULZ0-1]
XP_006721181.1, XM_006721118.1 [Q9ULZ0-1]
XP_006724967.1, XM_006724904.3 [Q9ULZ0-1]
XP_006724968.1, XM_006724905.3 [Q9ULZ0-2]
XP_011544081.1, XM_011545779.1 [Q9ULZ0-1]
XP_011544222.1, XM_011545920.1 [Q9ULZ0-1]
XP_011544235.1, XM_011545933.1 [Q9ULZ0-1]
XP_011544334.1, XM_011546032.1 [Q9ULZ0-1]
XP_011544335.1, XM_011546033.1 [Q9ULZ0-1]
XP_011544539.1, XM_011546237.1 [Q9ULZ0-1]
XP_011544540.1, XM_011546238.1 [Q9ULZ0-1]
XP_016878592.1, XM_017023103.1 [Q9ULZ0-1]
XP_016879081.1, XM_017023592.1 [Q9ULZ0-1]
XP_016879082.1, XM_017023593.1 [Q9ULZ0-1]
XP_016879124.1, XM_017023635.1 [Q9ULZ0-1]
XP_016879125.1, XM_017023636.1 [Q9ULZ0-1]
XP_016879126.1, XM_017023637.1 [Q9ULZ0-1]
XP_016879128.1, XM_017023639.1 [Q9ULZ0-1]
XP_016879441.1, XM_017023952.1 [Q9ULZ0-1]
XP_016879442.1, XM_017023953.1 [Q9ULZ0-1]
XP_016879446.1, XM_017023957.1 [Q9ULZ0-1]
XP_016879447.1, XM_017023958.1 [Q9ULZ0-1]
XP_016885615.1, XM_017030126.1 [Q9ULZ0-1]
XP_016885616.1, XM_017030127.1 [Q9ULZ0-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.513537
Hs.592038
Hs.624982
Hs.706716

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000341305; ENSP00000339405; ENSG00000261509 [Q9ULZ0-2]
ENST00000360260; ENSP00000353397; ENSG00000205457 [Q9ULZ0-3]
ENST00000380148; ENSP00000454398; ENSG00000205456 [Q9ULZ0-1]
ENST00000398664; ENSP00000455596; ENSG00000205456 [Q9ULZ0-2]
ENST00000398682; ENSP00000381672; ENSG00000183632 [Q9ULZ0-2]
ENST00000561509; ENSP00000455132; ENSG00000205457 [Q9ULZ0-2]
ENST00000565622; ENSP00000455448; ENSG00000183632 [Q9ULZ0-1]
ENST00000567137; ENSP00000454442; ENSG00000205457 [Q9ULZ0-3]
ENST00000567724; ENSP00000457303; ENSG00000261509 [Q9ULZ0-1]
ENST00000569420; ENSP00000457452; ENSG00000183632 [Q9ULZ0-3]
ENST00000569719; ENSP00000457790; ENSG00000205457 [Q9ULZ0-1]
ENST00000569741; ENSP00000456831; ENSG00000261509 [Q9ULZ0-3]
ENST00000611321; ENSP00000482283; ENSG00000275034 [Q9ULZ0-3]
ENST00000617705; ENSP00000481405; ENSG00000278848 [Q9ULZ0-3]
ENST00000623042; ENSP00000485635; ENSG00000278848 [Q9ULZ0-2]
ENST00000623491; ENSP00000485467; ENSG00000275034 [Q9ULZ0-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
102723655
102723713
102724101
102724127
24150
653550
729264
729355

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:102723655
hsa:102723713
hsa:102724101
hsa:102724127
hsa:24150
hsa:653550
hsa:729264
hsa:729355

UCSC genome browser

More...
UCSCi
uc002edd.5 human [Q9ULZ0-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB023508 mRNA Translation: BAA84978.1
AB023509 mRNA Translation: BAA84979.1
CR541650 mRNA Translation: CAG46451.1
AK312220 mRNA Translation: BAG35153.1
AL133588 mRNA Translation: CAH10710.1
BC096700 mRNA Translation: AAH96700.1
BC096733 mRNA Translation: AAH96733.1
BC098165 mRNA Translation: AAH98165.1
BC099842 mRNA Translation: AAH99842.1
CCDSiCCDS45475.1 [Q9ULZ0-2]
CCDS45477.1 [Q9ULZ0-2]
CCDS58456.1 [Q9ULZ0-2]
CCDS58458.1 [Q9ULZ0-2]
CCDS81974.1 [Q9ULZ0-2]
CCDS81976.1 [Q9ULZ0-2]
RefSeqiNP_001093157.1, NM_001099687.3 [Q9ULZ0-2]
NP_001192188.1, NM_001205259.2 [Q9ULZ0-2]
NP_001230651.1, NM_001243722.2 [Q9ULZ0-2]
NP_001316990.1, NM_001330061.1 [Q9ULZ0-2]
NP_001316995.1, NM_001330066.1 [Q9ULZ0-2]
NP_057296.1, NM_016212.4 [Q9ULZ0-2]
XP_006721089.1, XM_006721026.1 [Q9ULZ0-1]
XP_006721137.1, XM_006721074.2 [Q9ULZ0-1]
XP_006721147.1, XM_006721084.1 [Q9ULZ0-1]
XP_006721180.1, XM_006721117.2 [Q9ULZ0-1]
XP_006721181.1, XM_006721118.1 [Q9ULZ0-1]
XP_006724967.1, XM_006724904.3 [Q9ULZ0-1]
XP_006724968.1, XM_006724905.3 [Q9ULZ0-2]
XP_011544081.1, XM_011545779.1 [Q9ULZ0-1]
XP_011544222.1, XM_011545920.1 [Q9ULZ0-1]
XP_011544235.1, XM_011545933.1 [Q9ULZ0-1]
XP_011544334.1, XM_011546032.1 [Q9ULZ0-1]
XP_011544335.1, XM_011546033.1 [Q9ULZ0-1]
XP_011544539.1, XM_011546237.1 [Q9ULZ0-1]
XP_011544540.1, XM_011546238.1 [Q9ULZ0-1]
XP_016878592.1, XM_017023103.1 [Q9ULZ0-1]
XP_016879081.1, XM_017023592.1 [Q9ULZ0-1]
XP_016879082.1, XM_017023593.1 [Q9ULZ0-1]
XP_016879124.1, XM_017023635.1 [Q9ULZ0-1]
XP_016879125.1, XM_017023636.1 [Q9ULZ0-1]
XP_016879126.1, XM_017023637.1 [Q9ULZ0-1]
XP_016879128.1, XM_017023639.1 [Q9ULZ0-1]
XP_016879441.1, XM_017023952.1 [Q9ULZ0-1]
XP_016879442.1, XM_017023953.1 [Q9ULZ0-1]
XP_016879446.1, XM_017023957.1 [Q9ULZ0-1]
XP_016879447.1, XM_017023958.1 [Q9ULZ0-1]
XP_016885615.1, XM_017030126.1 [Q9ULZ0-1]
XP_016885616.1, XM_017030127.1 [Q9ULZ0-1]
UniGeneiHs.513537
Hs.592038
Hs.624982
Hs.706716

3D structure databases

ProteinModelPortaliQ9ULZ0
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi117300, 1 interactor
IntActiQ9ULZ0, 1 interactor

PTM databases

iPTMnetiQ9ULZ0
PhosphoSitePlusiQ9ULZ0

Polymorphism and mutation databases

BioMutaiTP53TG3

Proteomic databases

PaxDbiQ9ULZ0
PRIDEiQ9ULZ0
ProteomicsDBi85153
85154 [Q9ULZ0-2]
85155 [Q9ULZ0-3]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
24150
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000341305; ENSP00000339405; ENSG00000261509 [Q9ULZ0-2]
ENST00000360260; ENSP00000353397; ENSG00000205457 [Q9ULZ0-3]
ENST00000380148; ENSP00000454398; ENSG00000205456 [Q9ULZ0-1]
ENST00000398664; ENSP00000455596; ENSG00000205456 [Q9ULZ0-2]
ENST00000398682; ENSP00000381672; ENSG00000183632 [Q9ULZ0-2]
ENST00000561509; ENSP00000455132; ENSG00000205457 [Q9ULZ0-2]
ENST00000565622; ENSP00000455448; ENSG00000183632 [Q9ULZ0-1]
ENST00000567137; ENSP00000454442; ENSG00000205457 [Q9ULZ0-3]
ENST00000567724; ENSP00000457303; ENSG00000261509 [Q9ULZ0-1]
ENST00000569420; ENSP00000457452; ENSG00000183632 [Q9ULZ0-3]
ENST00000569719; ENSP00000457790; ENSG00000205457 [Q9ULZ0-1]
ENST00000569741; ENSP00000456831; ENSG00000261509 [Q9ULZ0-3]
ENST00000611321; ENSP00000482283; ENSG00000275034 [Q9ULZ0-3]
ENST00000617705; ENSP00000481405; ENSG00000278848 [Q9ULZ0-3]
ENST00000623042; ENSP00000485635; ENSG00000278848 [Q9ULZ0-2]
ENST00000623491; ENSP00000485467; ENSG00000275034 [Q9ULZ0-2]
GeneIDi102723655
102723713
102724101
102724127
24150
653550
729264
729355
KEGGihsa:102723655
hsa:102723713
hsa:102724101
hsa:102724127
hsa:24150
hsa:653550
hsa:729264
hsa:729355
UCSCiuc002edd.5 human [Q9ULZ0-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
102724101
102724127
24150
653550
729264
729355
EuPathDBiHostDB:ENSG00000183632.14
HostDB:ENSG00000205456.11
HostDB:ENSG00000205457.10
HostDB:ENSG00000261509.6

GeneCards: human genes, protein and diseases

More...
GeneCardsi
TP53TG3
TP53TG3B
TP53TG3C
TP53TG3D
TP53TG3E
TP53TG3F

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0038748
HIX0059557
HIX0173204
HIX0173288
HIX0173289
HGNCiHGNC:30759 TP53TG3
HGNC:37202 TP53TG3B
HGNC:42962 TP53TG3C
HGNC:44657 TP53TG3D
HGNC:51816 TP53TG3E
HGNC:51817 TP53TG3F
MIMi617482 gene
neXtProtiNX_Q9ULZ0
OpenTargetsiENSG00000183632
ENSG00000205456
ENSG00000205457
PharmGKBiPA165450804

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410KCDV Eukaryota
ENOG4110P2I LUCA
GeneTreeiENSGT00390000001729
HOGENOMiHOG000154671
InParanoidiQ9ULZ0
OMAiCREEPCC
OrthoDBiEOG09371IB9
PhylomeDBiQ9ULZ0
TreeFamiTF342471

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
TP53TG3C human

Protein Ontology

More...
PROi
PR:Q9ULZ0

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000183632 Expressed in 55 organ(s), highest expression level in right testis
ExpressionAtlasiQ9ULZ0 baseline and differential
GenevisibleiQ9ULZ0 HS

Family and domain databases

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiT53G3_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9ULZ0
Secondary accession number(s): B2R5K6, Q4KN31, Q9ULY9
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 8, 2008
Last sequence update: May 1, 2000
Last modified: November 7, 2018
This is version 113 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again