Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Coronin-1C

Gene

CORO1C

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Plays a role in directed cell migration by regulating the activation and subcellular location of RAC1 (PubMed:25074804, PubMed:25925950). Increases the presence of activated RAC1 at the leading edge of migrating cells (PubMed:25074804, PubMed:25925950). Required for normal organization of the cytoskeleton, including the actin cytoskeleton, microtubules and the vimentin intermediate filaments. Required for normal cell proliferation, cell migration, and normal formation of lamellipodia. Required for normal distribution of mitochondria within cells (By similarity).By similarity2 Publications
Isoform 3: Involved in myogenic differentiation.1 Publication

GO - Molecular functioni

  • actin filament binding Source: UniProtKB
  • Rac GTPase binding Source: Ensembl

GO - Biological processi

Keywordsi

Molecular functionActin-binding

Enzyme and pathway databases

SignaLinkiQ9ULV4
SIGNORiQ9ULV4

Names & Taxonomyi

Protein namesi
Recommended name:
Coronin-1C
Alternative name(s):
Coronin-31 Publication
hCRNN4
Gene namesi
Name:CORO1C
Synonyms:CRN21 Publication, CRNN4
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 12

Organism-specific databases

EuPathDBiHostDB:ENSG00000110880.10
HGNCiHGNC:2254 CORO1C
MIMi605269 gene
neXtProtiNX_Q9ULV4

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell junction, Cell membrane, Cell projection, Cytoplasm, Cytoskeleton, Membrane, Synapse

Pathology & Biotechi

Organism-specific databases

DisGeNETi23603
OpenTargetsiENSG00000110880
PharmGKBiPA26770

Polymorphism and mutation databases

DMDMi12643898

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000509261 – 474Coronin-1CAdd BLAST474

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei446N6-acetyllysineCombined sources1

Keywords - PTMi

Acetylation

Proteomic databases

EPDiQ9ULV4
PaxDbiQ9ULV4
PeptideAtlasiQ9ULV4
PRIDEiQ9ULV4
ProteomicsDBi85134

2D gel databases

OGPiQ9ULV4

PTM databases

GlyConnecti1157
iPTMnetiQ9ULV4
PhosphoSitePlusiQ9ULV4
SwissPalmiQ9ULV4

Expressioni

Tissue specificityi

Ubiquitous.1 Publication

Gene expression databases

BgeeiENSG00000110880 Expressed in 231 organ(s), highest expression level in tendon
CleanExiHS_CORO1C
ExpressionAtlasiQ9ULV4 baseline and differential
GenevisibleiQ9ULV4 HS

Organism-specific databases

HPAiHPA041737

Interactioni

Subunit structurei

Binds F-actin (PubMed:12377779, PubMed:22364218). Interacts with RCC2 (PubMed:25074804). Interacts preferentially with nucleotide-free and GDP-bound RAC1 (PubMed:25074804). Interacts with VIM (via head domain) (By similarity). Isoform 1 and isoform 2 appear as homotrimers, while isoform 3 seems to exist as monomers (PubMed:19651142).By similarity4 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
CORO1BQ9BR762EBI-351384,EBI-351152

GO - Molecular functioni

Protein-protein interaction databases

BioGridi117136, 109 interactors
DIPiDIP-33138N
IntActiQ9ULV4, 51 interactors
MINTiQ9ULV4
STRINGi9606.ENSP00000261401

Structurei

3D structure databases

ProteinModelPortaliQ9ULV4
SMRiQ9ULV4
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati25 – 70WD 1PROSITE-ProRule annotationAdd BLAST46
Repeati78 – 118WD 2PROSITE-ProRule annotation1 PublicationAdd BLAST41
Repeati128 – 168WD 3PROSITE-ProRule annotation1 PublicationAdd BLAST41
Repeati172 – 202WD 4PROSITE-ProRule annotation1 PublicationAdd BLAST31
Repeati215 – 249WD 5PROSITE-ProRule annotation1 PublicationAdd BLAST35
Repeati263 – 303WD 6PROSITE-ProRule annotation1 PublicationAdd BLAST41

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili436 – 4741 PublicationAdd BLAST39

Domaini

The C-terminal coiled-coil domain is essential for cortical membrane localization and oligomerization.

Sequence similaritiesi

Belongs to the WD repeat coronin family.Curated

Keywords - Domaini

Coiled coil, Repeat, WD repeat

Phylogenomic databases

eggNOGiKOG0303 Eukaryota
ENOG410XQAD LUCA
GeneTreeiENSGT00760000119195
HOGENOMiHOG000166356
HOVERGENiHBG059978
InParanoidiQ9ULV4
KOiK13886
OMAiENDKFEF
OrthoDBiEOG091G03H5
PhylomeDBiQ9ULV4
TreeFamiTF314280

Family and domain databases

Gene3Di2.130.10.10, 1 hit
InterProiView protein in InterPro
IPR027333 CORO1C
IPR015505 Coronin
IPR015048 DUF1899
IPR015943 WD40/YVTN_repeat-like_dom_sf
IPR001680 WD40_repeat
IPR019775 WD40_repeat_CS
IPR017986 WD40_repeat_dom
IPR036322 WD40_repeat_dom_sf
PANTHERiPTHR10856 PTHR10856, 1 hit
PTHR10856:SF10 PTHR10856:SF10, 1 hit
PfamiView protein in Pfam
PF08953 DUF1899, 1 hit
PF00400 WD40, 3 hits
SMARTiView protein in SMART
SM01166 DUF1899, 1 hit
SM00320 WD40, 3 hits
SUPFAMiSSF50978 SSF50978, 1 hit
PROSITEiView protein in PROSITE
PS00678 WD_REPEATS_1, 1 hit
PS50082 WD_REPEATS_2, 3 hits
PS50294 WD_REPEATS_REGION, 1 hit

Sequences (3+)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 9 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9ULV4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MRRVVRQSKF RHVFGQAVKN DQCYDDIRVS RVTWDSSFCA VNPRFVAIII
60 70 80 90 100
EASGGGAFLV LPLHKTGRID KSYPTVCGHT GPVLDIDWCP HNDQVIASGS
110 120 130 140 150
EDCTVMVWQI PENGLTLSLT EPVVILEGHS KRVGIVAWHP TARNVLLSAG
160 170 180 190 200
CDNAIIIWNV GTGEALINLD DMHSDMIYNV SWNRNGSLIC TASKDKKVRV
210 220 230 240 250
IDPRKQEIVA EKEKAHEGAR PMRAIFLADG NVFTTGFSRM SERQLALWNP
260 270 280 290 300
KNMQEPIALH EMDTSNGVLL PFYDPDTSII YLCGKGDSSI RYFEITDESP
310 320 330 340 350
YVHYLNTFSS KEPQRGMGYM PKRGLDVNKC EIARFFKLHE RKCEPIIMTV
360 370 380 390 400
PRKSDLFQDD LYPDTAGPEA ALEAEEWFEG KNADPILISL KHGYIPGKNR
410 420 430 440 450
DLKVVKKNIL DSKPTANKKC DLISIPKKTT DTASVQNEAK LDEILKEIKS
460 470
IKDTICNQDE RISKLEQQMA KIAA
Length:474
Mass (Da):53,249
Last modified:May 1, 2000 - v1
Checksum:iC7256797C514BB53
GO
Isoform 2 (identifier: Q9ULV4-2) [UniParc]FASTAAdd to basket
Also known as: CRN2i2

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MRWKDTM

Show »
Length:480
Mass (Da):54,067
Checksum:i75590C081614A540
GO
Isoform 3 (identifier: Q9ULV4-3) [UniParc]FASTAAdd to basket
Also known as: CRN2i3

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MYGPGSQLGKSGNNSWAKERGCSIACQGSLTSARLHAPSIGERPLSHMRWKDTM

Note: Exclusively expressed in well-differentiated myoblasts as well as in mature skeletal muscle.
Show »
Length:527
Mass (Da):58,947
Checksum:i11C115B9F0B8D722
GO

Computationally mapped potential isoform sequencesi

There are 9 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F8VV53F8VV53_HUMAN
Coronin
CORO1C
125Annotation score:
B4E3S0B4E3S0_HUMAN
Coronin
CORO1C
369Annotation score:
F8VVB7F8VVB7_HUMAN
Coronin
CORO1C
181Annotation score:
F8W1H8F8W1H8_HUMAN
Coronin
CORO1C
151Annotation score:
F8VSA4F8VSA4_HUMAN
Coronin
CORO1C
162Annotation score:
F8VUX3F8VUX3_HUMAN
Coronin
CORO1C
159Annotation score:
F8VTT6F8VTT6_HUMAN
Coronin
CORO1C
169Annotation score:
F8VRE9F8VRE9_HUMAN
Coronin
CORO1C
163Annotation score:
H0YHL7H0YHL7_HUMAN
Coronin-1C
CORO1C
165Annotation score:

Sequence cautioni

The sequence CAB82406 differs from that shown. Reason: Erroneous initiation.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0477271M → MRWKDTM in isoform 2. 1 Publication1
Alternative sequenceiVSP_0477281M → MYGPGSQLGKSGNNSWAKER GCSIACQGSLTSARLHAPSI GERPLSHMRWKDTM in isoform 3. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB030656 mRNA Translation: BAA83077.1
AM849477 mRNA Translation: CAO94662.1
AM849478 mRNA Translation: CAO94663.1
AK096363 mRNA Translation: BAG53274.1
AL162070 mRNA Translation: CAB82406.1 Different initiation.
AC007569 Genomic DNA No translation available.
CH471054 Genomic DNA Translation: EAW97826.1
BC002342 mRNA Translation: AAH02342.1
CCDSiCCDS61236.1 [Q9ULV4-3]
CCDS9120.1 [Q9ULV4-1]
RefSeqiNP_001098707.1, NM_001105237.2 [Q9ULV4-3]
NP_001263400.1, NM_001276471.1 [Q9ULV4-1]
NP_055140.1, NM_014325.3 [Q9ULV4-1]
XP_016874610.1, XM_017019121.1 [Q9ULV4-3]
XP_016874611.1, XM_017019122.1 [Q9ULV4-1]
XP_016874612.1, XM_017019123.1 [Q9ULV4-1]
UniGeneiHs.330384

Genome annotation databases

EnsembliENST00000261401; ENSP00000261401; ENSG00000110880 [Q9ULV4-1]
ENST00000420959; ENSP00000394496; ENSG00000110880 [Q9ULV4-3]
ENST00000541050; ENSP00000438341; ENSG00000110880 [Q9ULV4-1]
ENST00000549772; ENSP00000447534; ENSG00000110880 [Q9ULV4-2]
GeneIDi23603
KEGGihsa:23603
UCSCiuc001tnj.6 human [Q9ULV4-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB030656 mRNA Translation: BAA83077.1
AM849477 mRNA Translation: CAO94662.1
AM849478 mRNA Translation: CAO94663.1
AK096363 mRNA Translation: BAG53274.1
AL162070 mRNA Translation: CAB82406.1 Different initiation.
AC007569 Genomic DNA No translation available.
CH471054 Genomic DNA Translation: EAW97826.1
BC002342 mRNA Translation: AAH02342.1
CCDSiCCDS61236.1 [Q9ULV4-3]
CCDS9120.1 [Q9ULV4-1]
RefSeqiNP_001098707.1, NM_001105237.2 [Q9ULV4-3]
NP_001263400.1, NM_001276471.1 [Q9ULV4-1]
NP_055140.1, NM_014325.3 [Q9ULV4-1]
XP_016874610.1, XM_017019121.1 [Q9ULV4-3]
XP_016874611.1, XM_017019122.1 [Q9ULV4-1]
XP_016874612.1, XM_017019123.1 [Q9ULV4-1]
UniGeneiHs.330384

3D structure databases

ProteinModelPortaliQ9ULV4
SMRiQ9ULV4
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi117136, 109 interactors
DIPiDIP-33138N
IntActiQ9ULV4, 51 interactors
MINTiQ9ULV4
STRINGi9606.ENSP00000261401

PTM databases

GlyConnecti1157
iPTMnetiQ9ULV4
PhosphoSitePlusiQ9ULV4
SwissPalmiQ9ULV4

Polymorphism and mutation databases

DMDMi12643898

2D gel databases

OGPiQ9ULV4

Proteomic databases

EPDiQ9ULV4
PaxDbiQ9ULV4
PeptideAtlasiQ9ULV4
PRIDEiQ9ULV4
ProteomicsDBi85134

Protocols and materials databases

DNASUi23603
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000261401; ENSP00000261401; ENSG00000110880 [Q9ULV4-1]
ENST00000420959; ENSP00000394496; ENSG00000110880 [Q9ULV4-3]
ENST00000541050; ENSP00000438341; ENSG00000110880 [Q9ULV4-1]
ENST00000549772; ENSP00000447534; ENSG00000110880 [Q9ULV4-2]
GeneIDi23603
KEGGihsa:23603
UCSCiuc001tnj.6 human [Q9ULV4-1]

Organism-specific databases

CTDi23603
DisGeNETi23603
EuPathDBiHostDB:ENSG00000110880.10
GeneCardsiCORO1C
HGNCiHGNC:2254 CORO1C
HPAiHPA041737
MIMi605269 gene
neXtProtiNX_Q9ULV4
OpenTargetsiENSG00000110880
PharmGKBiPA26770
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0303 Eukaryota
ENOG410XQAD LUCA
GeneTreeiENSGT00760000119195
HOGENOMiHOG000166356
HOVERGENiHBG059978
InParanoidiQ9ULV4
KOiK13886
OMAiENDKFEF
OrthoDBiEOG091G03H5
PhylomeDBiQ9ULV4
TreeFamiTF314280

Enzyme and pathway databases

SignaLinkiQ9ULV4
SIGNORiQ9ULV4

Miscellaneous databases

ChiTaRSiCORO1C human
GeneWikiiCORO1C
GenomeRNAii23603
PROiPR:Q9ULV4
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000110880 Expressed in 231 organ(s), highest expression level in tendon
CleanExiHS_CORO1C
ExpressionAtlasiQ9ULV4 baseline and differential
GenevisibleiQ9ULV4 HS

Family and domain databases

Gene3Di2.130.10.10, 1 hit
InterProiView protein in InterPro
IPR027333 CORO1C
IPR015505 Coronin
IPR015048 DUF1899
IPR015943 WD40/YVTN_repeat-like_dom_sf
IPR001680 WD40_repeat
IPR019775 WD40_repeat_CS
IPR017986 WD40_repeat_dom
IPR036322 WD40_repeat_dom_sf
PANTHERiPTHR10856 PTHR10856, 1 hit
PTHR10856:SF10 PTHR10856:SF10, 1 hit
PfamiView protein in Pfam
PF08953 DUF1899, 1 hit
PF00400 WD40, 3 hits
SMARTiView protein in SMART
SM01166 DUF1899, 1 hit
SM00320 WD40, 3 hits
SUPFAMiSSF50978 SSF50978, 1 hit
PROSITEiView protein in PROSITE
PS00678 WD_REPEATS_1, 1 hit
PS50082 WD_REPEATS_2, 3 hits
PS50294 WD_REPEATS_REGION, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiCOR1C_HUMAN
AccessioniPrimary (citable) accession number: Q9ULV4
Secondary accession number(s): A7MAP0
, A7MAP1, B3KU12, Q9NSK5
Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 11, 2001
Last sequence update: May 1, 2000
Last modified: November 7, 2018
This is version 172 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again