Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 157 (18 Sep 2019)
Sequence version 3 (10 Jan 2006)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Calcium-dependent secretion activator 1

Gene

CADPS

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Calcium-binding protein involved in exocytosis of vesicles filled with neurotransmitters and neuropeptides. Probably acts upstream of fusion in the biogenesis or maintenance of mature secretory vesicles. Regulates catecholamine loading of DCVs. May specifically mediate the Ca2+-dependent exocytosis of large dense-core vesicles (DCVs) and other dense-core vesicles by acting as a PtdIns(4,5)P2-binding protein that acts at prefusion step following ATP-dependent priming and participates in DCVs-membrane fusion. However, it may also participate in small clear synaptic vesicles (SVs) exocytosis and it is unclear whether its function is related to Ca2+ triggering (By similarity).By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processExocytosis, Protein transport, Transport
LigandCalcium, Lipid-binding, Metal-binding

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Calcium-dependent secretion activator 1
Alternative name(s):
Calcium-dependent activator protein for secretion 1
Short name:
CAPS-1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CADPS
Synonyms:CAPS, CAPS1, KIAA1121
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 3

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:1426 CADPS

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
604667 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9ULU8

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell junction, Cytoplasmic vesicle, Membrane, Synapse

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
8618

Open Targets

More...
OpenTargetsi
ENSG00000163618

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA26024

Chemistry databases

Drug and drug target database

More...
DrugBanki
DB11093 Calcium Citrate
DB11348 Calcium Phosphate
DB14481 Calcium phosphate dihydrate

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
CADPS

Domain mapping of disease mutations (DMDM)

More...
DMDMi
85540963

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000538641 – 1353Calcium-dependent secretion activator 1Add BLAST1353

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei34PhosphoserineBy similarity1
Modified residuei91PhosphoserineBy similarity1
Modified residuei98PhosphoserineBy similarity1
Modified residuei261PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9ULU8

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9ULU8

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q9ULU8

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9ULU8

PeptideAtlas

More...
PeptideAtlasi
Q9ULU8

PRoteomics IDEntifications database

More...
PRIDEi
Q9ULU8

ProteomicsDB human proteome resource

More...
ProteomicsDBi
85123 [Q9ULU8-1]
85124 [Q9ULU8-2]
85125 [Q9ULU8-3]
85126 [Q9ULU8-4]
85127 [Q9ULU8-5]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9ULU8

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9ULU8

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q9ULU8

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Specifically expressed in neural and endocrine secretory tissues. Expressed in brain and pancreas and at low level in heart. Also expressed in fetal heart, cerebellum, cerebral cortex, medulla, occipital pole, frontal and temporal lobes, and putamen, as well as weak expression in spinal cord.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000163618 Expressed in 142 organ(s), highest expression level in frontal cortex

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9ULU8 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9ULU8 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA059328

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer (By similarity).

Interacts with RASL10B (By similarity).

Interacts with the dopamine receptor DRD2.

By similarity1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
114174, 11 interactors

Protein interaction database and analysis system

More...
IntActi
Q9ULU8, 13 interactors

Molecular INTeraction database

More...
MINTi
Q9ULU8

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000373215

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

11353
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9ULU8

Database of comparative protein structure models

More...
ModBasei
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q9ULU8

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini400 – 481C2Add BLAST82
Domaini521 – 624PHPROSITE-ProRule annotationAdd BLAST104
Domaini931 – 1111MHD1PROSITE-ProRule annotationAdd BLAST181

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni790 – 1129Interaction with DRD21 PublicationAdd BLAST340
Regioni1177 – 1353Mediates targeting and association with DCVsBy similarityAdd BLAST177

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The PH domain is essential for regulated exocytosis and binds phospholipids and plasma membrane. It however does not mediate binding to DCVs (By similarity).By similarity

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3543 Eukaryota
ENOG410Y0FD LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00950000183306

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9ULU8

KEGG Orthology (KO)

More...
KOi
K19933

Identification of Orthologs from Complete Genome Data

More...
OMAi
YISADPC

Database of Orthologous Groups

More...
OrthoDBi
138870at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9ULU8

TreeFam database of animal gene trees

More...
TreeFami
TF312963

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.30.29.30, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR033227 CAPS
IPR010439 CAPS_dom
IPR014770 Munc13_1
IPR011993 PH-like_dom_sf
IPR001849 PH_domain

The PANTHER Classification System

More...
PANTHERi
PTHR12166 PTHR12166, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF06292 DUF1041, 1 hit
PF00169 PH, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM01145 DUF1041, 1 hit
SM00233 PH, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51258 MHD1, 1 hit
PS50003 PH_DOMAIN, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 7 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9ULU8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MLDPSSSEEE SDEIVEEESG KEVLGSAPSG ARLSPSRTSE GSAGSAGLGG
60 70 80 90 100
GGAGAGAGVG AGGGGGSGAS SGGGAGGLQP SSRAGGGRPS SPSPSVVSEK
110 120 130 140 150
EKEELERLQK EEEERKKRLQ LYVFVMRCIA YPFNAKQPTD MARRQQKISK
160 170 180 190 200
QQLQTVKDRF QAFLNGETQI MADEAFMNAV QSYYEVFLKS DRVARMVQSG
210 220 230 240 250
GCSANDSREV FKKHIEKRVR SLPEIDGLSK ETVLSSWMAK FDAIYRGEED
260 270 280 290 300
PRKQQARMTA SAASELILSK EQLYEMFQNI LGIKKFEHQL LYNACQLDNP
310 320 330 340 350
DEQAAQIRRE LDGRLQMADQ IARERKFPKF VSKEMENMYI EELKSSVNLL
360 370 380 390 400
MANLESMPVS KGGEFKLQKL KRSHNASIID MGEESENQLS KSDVVLSFSL
410 420 430 440 450
EVVIMEVQGL KSLAPNRIVY CTMEVEGGEK LQTDQAEASK PTWGTQGDFS
460 470 480 490 500
TTHALPAVKV KLFTESTGVL ALEDKELGRV ILHPTPNSPK QSEWHKMTVS
510 520 530 540 550
KNCPDQDLKI KLAVRMDKPQ NMKHSGYLWA IGKNVWKRWK KRFFVLVQVS
560 570 580 590 600
QYTFAMCSYR EKKAEPQELL QLDGYTVDYT DPQPGLEGGR AFFNAVKEGD
610 620 630 640 650
TVIFASDDEQ DRILWVQAMY RATGQSHKPV PPTQVQKLNA KGGNVPQLDA
660 670 680 690 700
PISQFYADRA QKHGMDEFIS SNPCNFDHAS LFEMVQRLTL DHRLNDSYSC
710 720 730 740 750
LGWFSPGQVF VLDEYCARNG VRGCHRHLCY LRDLLERAEN GAMIDPTLLH
760 770 780 790 800
YSFAFCASHV HGNRPDGIGT VTVEEKERFE EIKERLRVLL ENQITHFRYC
810 820 830 840 850
FPFGRPEGAL KATLSLLERV LMKDIVTPVP QEEVKTVIRK CLEQAALVNY
860 870 880 890 900
SRLSEYAKIE ENQKDAENVG RLITPAKKLE DTIRLAELVI EVLQQNEEHH
910 920 930 940 950
AEPHVDKGEA FAWWSDLMVE HAETFLSLFA VDMDAALEVQ PPDTWDSFPL
960 970 980 990 1000
FQLLNDFLRT DYNLCNGKFH KHLQDLFAPL VVRYVDLMES SIAQSIHRGF
1010 1020 1030 1040 1050
ERESWEPVKS LTSNLPNVNL PNVNLPKVPN LPVNIPLGIP QMPTFSAPSW
1060 1070 1080 1090 1100
MAAIYDADNG SGTSEDLFWK LDALQTFIRD LHWPEEEFGK HLEQRLKLMA
1110 1120 1130 1140 1150
SDMIESCVKR TRIAFEVKLQ KTSRSTDFRV PQSICTMFNV MVDAKAQSTK
1160 1170 1180 1190 1200
LCSMEMGQEH QYHSKIDELI EETVKEMITL LVAKFVTILE GVLAKLSRYD
1210 1220 1230 1240 1250
EGTLFSSFLS FTVKAASKYV DVPKPGMDVA DAYVTFVRHS QDVLRDKVNE
1260 1270 1280 1290 1300
EMYIERLFDQ WYNSSMNVIC TWLTDRMDLQ LHIYQLKTLI RMVKKTYRDF
1310 1320 1330 1340 1350
RLQGVLDSTL NSKTYETIRN RLTVEEATAS VSEGGGLQGI SMKDSDEEDE

EDD
Length:1,353
Mass (Da):152,786
Last modified:January 10, 2006 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i9911C50B3A507112
GO
Isoform 2 (identifier: Q9ULU8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     685-701: Missing.
     861-866: Missing.
     902-908: Missing.
     1009-1058: KSLTSNLPNVNLPNVNLPKVPNLPVNIPLGIPQMPTFSAPSWMAAIYDAD → N

Show »
Length:1,274
Mass (Da):144,084
Checksum:iB253C07E4964F651
GO
Isoform 3 (identifier: Q9ULU8-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     861-867: ENQKDAE → GKKREMYEHPVFCLASQVMDLTIQ
     902-908: Missing.
     1009-1058: KSLTSNLPNVNLPNVNLPKVPNLPVNIPLGIPQMPTFSAPSWMAAIYDAD → N

Note: No experimental confirmation available.
Show »
Length:1,314
Mass (Da):148,776
Checksum:i096F89AE6506C1CC
GO
Isoform 4 (identifier: Q9ULU8-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1159-1159: E → EFAKMW

Show »
Length:1,358
Mass (Da):153,450
Checksum:i384A4097EC5B41A4
GO
Isoform 5 (identifier: Q9ULU8-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     443-457: WGTQGDFSTTHALPA → VIRRNRREQLPHSAI
     458-1353: Missing.

Note: No experimental confirmation available.
Show »
Length:457
Mass (Da):50,236
Checksum:i06A44C79DF4DE69B
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 7 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F1T0E5F1T0E5_HUMAN
Calcium-dependent secretion activat...
CADPS
1,344Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C4P2H7C4P2_HUMAN
Calcium-dependent secretion activat...
CADPS
240Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C4T6H7C4T6_HUMAN
Calcium-dependent secretion activat...
CADPS
311Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C538H7C538_HUMAN
Calcium-dependent secretion activat...
CADPS
345Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0C4DGY2A0A0C4DGY2_HUMAN
Calcium-dependent secretion activat...
CADPS
222Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YFP0H0YFP0_HUMAN
Calcium-dependent secretion activat...
CADPS
212Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C4K9H7C4K9_HUMAN
Calcium-dependent secretion activat...
CADPS
190Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAA79701 differs from that shown. Reason: Frameshift at positions 1305 and 1317.Curated
The sequence AAH15754 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAA86435 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti62G → S in AAM61861 (PubMed:12659812).Curated1
Sequence conflicti1197S → Y in AAA79701 (PubMed:9289490).Curated1
Sequence conflicti1230A → P in AAA79701 (PubMed:9289490).Curated1
Sequence conflicti1237V → G in AAA79701 (PubMed:9289490).Curated1
Sequence conflicti1250E → G in AAM61861 (PubMed:12659812).Curated1
Sequence conflicti1250E → G in CAD38751 (PubMed:17974005).Curated1
Sequence conflicti1292M → V in BAA86435 (PubMed:10574461).Curated1
Sequence conflicti1310L → F in AAM61861 (PubMed:12659812).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_016801443 – 457WGTQG…HALPA → VIRRNRREQLPHSAI in isoform 5. 1 PublicationAdd BLAST15
Alternative sequenceiVSP_016802458 – 1353Missing in isoform 5. 1 PublicationAdd BLAST896
Alternative sequenceiVSP_016803685 – 701Missing in isoform 2. 1 PublicationAdd BLAST17
Alternative sequenceiVSP_016804861 – 867ENQKDAE → GKKREMYEHPVFCLASQVMD LTIQ in isoform 3. 1 Publication7
Alternative sequenceiVSP_016805861 – 866Missing in isoform 2. 1 Publication6
Alternative sequenceiVSP_016806902 – 908Missing in isoform 2 and isoform 3. 2 Publications7
Alternative sequenceiVSP_0168071009 – 1058KSLTS…IYDAD → N in isoform 2 and isoform 3. 2 PublicationsAdd BLAST50
Alternative sequenceiVSP_0168081159E → EFAKMW in isoform 4. 2 Publications1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF458662 mRNA Translation: AAM61861.1
AB032947 mRNA Translation: BAA86435.2 Different initiation.
AC104161 Genomic DNA No translation available.
AL833895 mRNA Translation: CAD38751.1
U36448 mRNA Translation: AAA79701.1 Frameshift.
BC015754 mRNA Translation: AAH15754.1 Different initiation.
BC029460 mRNA Translation: AAH29460.1
BC072684 mRNA Translation: AAH72684.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS2898.1 [Q9ULU8-2]
CCDS2899.1 [Q9ULU8-3]
CCDS46858.1 [Q9ULU8-1]

NCBI Reference Sequences

More...
RefSeqi
NP_003707.2, NM_003716.3 [Q9ULU8-1]
NP_899630.1, NM_183393.2 [Q9ULU8-2]
NP_899631.1, NM_183394.2 [Q9ULU8-3]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000283269; ENSP00000283269; ENSG00000163618 [Q9ULU8-3]
ENST00000357948; ENSP00000350632; ENSG00000163618 [Q9ULU8-2]
ENST00000383710; ENSP00000373215; ENSG00000163618 [Q9ULU8-1]
ENST00000490353; ENSP00000418736; ENSG00000163618 [Q9ULU8-5]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
8618

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:8618

UCSC genome browser

More...
UCSCi
uc003dll.3 human [Q9ULU8-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF458662 mRNA Translation: AAM61861.1
AB032947 mRNA Translation: BAA86435.2 Different initiation.
AC104161 Genomic DNA No translation available.
AL833895 mRNA Translation: CAD38751.1
U36448 mRNA Translation: AAA79701.1 Frameshift.
BC015754 mRNA Translation: AAH15754.1 Different initiation.
BC029460 mRNA Translation: AAH29460.1
BC072684 mRNA Translation: AAH72684.1
CCDSiCCDS2898.1 [Q9ULU8-2]
CCDS2899.1 [Q9ULU8-3]
CCDS46858.1 [Q9ULU8-1]
RefSeqiNP_003707.2, NM_003716.3 [Q9ULU8-1]
NP_899630.1, NM_183393.2 [Q9ULU8-2]
NP_899631.1, NM_183394.2 [Q9ULU8-3]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1WI1NMR-A522-634[»]
SMRiQ9ULU8
ModBaseiSearch...

Protein-protein interaction databases

BioGridi114174, 11 interactors
IntActiQ9ULU8, 13 interactors
MINTiQ9ULU8
STRINGi9606.ENSP00000373215

Chemistry databases

DrugBankiDB11093 Calcium Citrate
DB11348 Calcium Phosphate
DB14481 Calcium phosphate dihydrate

PTM databases

iPTMnetiQ9ULU8
PhosphoSitePlusiQ9ULU8
SwissPalmiQ9ULU8

Polymorphism and mutation databases

BioMutaiCADPS
DMDMi85540963

Proteomic databases

EPDiQ9ULU8
jPOSTiQ9ULU8
MassIVEiQ9ULU8
PaxDbiQ9ULU8
PeptideAtlasiQ9ULU8
PRIDEiQ9ULU8
ProteomicsDBi85123 [Q9ULU8-1]
85124 [Q9ULU8-2]
85125 [Q9ULU8-3]
85126 [Q9ULU8-4]
85127 [Q9ULU8-5]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000283269; ENSP00000283269; ENSG00000163618 [Q9ULU8-3]
ENST00000357948; ENSP00000350632; ENSG00000163618 [Q9ULU8-2]
ENST00000383710; ENSP00000373215; ENSG00000163618 [Q9ULU8-1]
ENST00000490353; ENSP00000418736; ENSG00000163618 [Q9ULU8-5]
GeneIDi8618
KEGGihsa:8618
UCSCiuc003dll.3 human [Q9ULU8-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
8618
DisGeNETi8618

GeneCards: human genes, protein and diseases

More...
GeneCardsi
CADPS
HGNCiHGNC:1426 CADPS
HPAiHPA059328
MIMi604667 gene
neXtProtiNX_Q9ULU8
OpenTargetsiENSG00000163618
PharmGKBiPA26024

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3543 Eukaryota
ENOG410Y0FD LUCA
GeneTreeiENSGT00950000183306
InParanoidiQ9ULU8
KOiK19933
OMAiYISADPC
OrthoDBi138870at2759
PhylomeDBiQ9ULU8
TreeFamiTF312963

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
CADPS human
EvolutionaryTraceiQ9ULU8

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
CADPS

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
8618

Pharos

More...
Pharosi
Q9ULU8

Protein Ontology

More...
PROi
PR:Q9ULU8

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000163618 Expressed in 142 organ(s), highest expression level in frontal cortex
ExpressionAtlasiQ9ULU8 baseline and differential
GenevisibleiQ9ULU8 HS

Family and domain databases

Gene3Di2.30.29.30, 1 hit
InterProiView protein in InterPro
IPR033227 CAPS
IPR010439 CAPS_dom
IPR014770 Munc13_1
IPR011993 PH-like_dom_sf
IPR001849 PH_domain
PANTHERiPTHR12166 PTHR12166, 1 hit
PfamiView protein in Pfam
PF06292 DUF1041, 1 hit
PF00169 PH, 1 hit
SMARTiView protein in SMART
SM01145 DUF1041, 1 hit
SM00233 PH, 1 hit
PROSITEiView protein in PROSITE
PS51258 MHD1, 1 hit
PS50003 PH_DOMAIN, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCAPS1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9ULU8
Secondary accession number(s): A6NF60
, Q13339, Q6GQQ6, Q8N2Z5, Q8N3M7, Q8NFR0, Q96BC2
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 10, 2006
Last sequence update: January 10, 2006
Last modified: September 18, 2019
This is version 157 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again