Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 189 (13 Nov 2019)
Sequence version 2 (25 Nov 2002)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Protein kinase C-binding protein 1

Gene

ZMYND8

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May act as a transcriptional corepressor for KDM5D. Required for KDM5D-mediated down-regulation of diverse metastasis-associated genes; the function seems to involve the recognition of the dual histone signature H3K4me1-H3K14ac. Suppresses prostate cancer cell invasion.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the ‘Description’ field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi91Zinc 1Combined sources1 Publication1
Metal bindingi94Zinc 1Combined sources1 Publication1
Metal bindingi103Zinc 2Combined sources1 Publication1
Metal bindingi106Zinc 2Combined sources1 Publication1
Metal bindingi111Zinc 1; via pros nitrogenCombined sources1 Publication1
Metal bindingi114Zinc 1Combined sources1 Publication1
Metal bindingi127Zinc 2Combined sources1 Publication1
Metal bindingi130Zinc 2Combined sources1 Publication1
Metal bindingi255Zinc 3Combined sources1 Publication1
Metal bindingi258Zinc 3Combined sources1 Publication1
Metal bindingi274Zinc 3Combined sources1 Publication1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri88 – 133PHD-typePROSITE-ProRule annotationAdd BLAST46
Zinc fingeri1028 – 1062MYND-typePROSITE-ProRule annotationAdd BLAST35

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processTranscription, Transcription regulation
LigandMetal-binding, Zinc

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Protein kinase C-binding protein 1
Alternative name(s):
Cutaneous T-cell lymphoma-associated antigen se14-3
Short name:
CTCL-associated antigen se14-3
Rack7
Zinc finger MYND domain-containing protein 8
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ZMYND8
Synonyms:KIAA1125, PRKCBP1, RACK7
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 20

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:9397 ZMYND8

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9ULU4

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi76D → A: Decreases interaction with histone H3K4me0. 1 Publication1
Mutagenesisi79D → A: Decreases interaction with histone H3K4me0. 1 Publication1
Mutagenesisi84D → A: Decreases interaction with histone H3K4me0. 1 Publication1
Mutagenesisi88D → A: Decreases interaction with histone H3K4me0. 1 Publication1
Mutagenesisi89F → D: Increases interaction with histone H3K4me0. 1 Publication1
Mutagenesisi104E → A: Decreases interaction with histone H3K4me0. 1 Publication1
Mutagenesisi227 – 228YN → AA: Decreases interaction with histone H3K4me0. 1 Publication2
Mutagenesisi240V → Q: Decreases binding to DBN1. 1 Publication1
Mutagenesisi311H → A: Loss of binding to DBN1. Loss of cytoplasmic localization. 1 Publication1
Mutagenesisi312D → R: Loss of binding to DBN1. 1 Publication1

Organism-specific databases

DisGeNET

More...
DisGeNETi
23613

Open Targets

More...
OpenTargetsi
ENSG00000101040

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA162409890

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q9ULU4

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL3627580

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ZMYND8

Domain mapping of disease mutations (DMDM)

More...
DMDMi
25453223

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002112091 – 1186Protein kinase C-binding protein 1Add BLAST1186

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei24PhosphoserineCombined sources1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki56Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki70Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki390Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei404PhosphothreonineCombined sources1
Modified residuei406PhosphoserineCombined sources1
Modified residuei413N6-acetyllysine; alternateCombined sources1
Cross-linki413Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternateCombined sources
Modified residuei417PhosphoserineCombined sources1
Modified residuei425PhosphoserineCombined sources1
Modified residuei432PhosphoserineCombined sources1
Modified residuei444PhosphoserineCombined sources1
Cross-linki453Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei460PhosphoserineCombined sources1
Modified residuei462PhosphoserineCombined sources1
Modified residuei465PhosphoserineCombined sources1
Modified residuei486PhosphoserineCombined sources1
Modified residuei490PhosphoserineCombined sources1
Modified residuei495PhosphoserineCombined sources1
Cross-linki505Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei514PhosphoserineCombined sources1
Modified residuei523PhosphoserineCombined sources1
Cross-linki530Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei541PhosphothreonineCombined sources1
Modified residuei547PhosphoserineCombined sources1
Cross-linki549Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei563PhosphothreonineCombined sources1
Cross-linki611Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki645Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei652PhosphoserineCombined sources1
Modified residuei655PhosphoserineCombined sources1
Cross-linki657Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei668PhosphoserineCombined sources1
Modified residuei682PhosphoserineCombined sources1
Modified residuei707PhosphoserineCombined sources1
Modified residuei709PhosphoserineCombined sources1
Modified residuei737PhosphoserineCombined sources1
Modified residuei746PhosphothreonineCombined sources1
Modified residuei754PhosphoserineCombined sources1
Modified residuei756PhosphoserineCombined sources1
Cross-linki1115Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei1119PhosphoserineCombined sources1
Modified residuei1141PhosphoserineCombined sources1
Isoform 5 (identifier: Q9ULU4-5)
Cross-linki12Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Isoform 7 (identifier: Q9ULU4-7)
Cross-linki12Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Isoform 8 (identifier: Q9ULU4-8)
Cross-linki12Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Isoform 10 (identifier: Q9ULU4-10)
Cross-linki12Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Isoform 12 (identifier: Q9ULU4-12)
Cross-linki12Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Isoform 13 (identifier: Q9ULU4-13)
Cross-linki12Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Isoform 14 (identifier: Q9ULU4-14)
Cross-linki12Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Isoform 15 (identifier: Q9ULU4-15)
Cross-linki12Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Isoform 16 (identifier: Q9ULU4-16)
Cross-linki12Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Isoform 17 (identifier: Q9ULU4-17)
Cross-linki12Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Isoform 18 (identifier: Q9ULU4-18)
Cross-linki12Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Isoform 22 (identifier: Q9ULU4-22)
Cross-linki12Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources

Keywords - PTMi

Acetylation, Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9ULU4

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9ULU4

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q9ULU4

PeptideAtlas

More...
PeptideAtlasi
Q9ULU4

PRoteomics IDEntifications database

More...
PRIDEi
Q9ULU4

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
25473
44416
61294
61295
7246
85109 [Q9ULU4-1]
85110 [Q9ULU4-10]
85111 [Q9ULU4-11]
85112 [Q9ULU4-12]
85113 [Q9ULU4-13]
85114 [Q9ULU4-14]
85115 [Q9ULU4-2]
85116 [Q9ULU4-3]
85117 [Q9ULU4-4]
85118 [Q9ULU4-5]
85119 [Q9ULU4-6]
85120 [Q9ULU4-7]
85121 [Q9ULU4-8]
85122 [Q9ULU4-9]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9ULU4

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9ULU4

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in all tissues examined with highest expression in brain, lung, pancreas, and placenta. Expressed in cutaneous T-cell lymphomas (CTCL).

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000101040 Expressed in 247 organ(s), highest expression level in caput epididymis

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9ULU4 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9ULU4 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA020949

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts in vitro with PRKCB1 (PubMed:11003709).

Interacts with KDM5D and KDM1A (PubMed:27477906).

Interacts with histone H3 (via N-terminus) that is both methylated at 'Lys-4' (H3K4me1) and acetylated at 'Lys-14' (H3K14ac), and with histone H3 (via N-terminus) unmodified at 'Lys-4' (H3K4me0) and acetylated at 'Lys-14' (H3K14ac) (PubMed:27477906).

Interacts (via PHD-type Zinc finger, Bromo and PWWP domains) with DBN1 (via ADF-H domain); the interaction leads to sequestering of ZMYND8 in the cytoplasm (PubMed:28966017).

3 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
117146, 70 interactors

Protein interaction database and analysis system

More...
IntActi
Q9ULU4, 52 interactors

Molecular INTeraction database

More...
MINTi
Q9ULU4

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000420095

Chemistry databases

BindingDB database of measured binding affinities

More...
BindingDBi
Q9ULU4

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

11186
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9ULU4

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini165 – 235BromoPROSITE-ProRule annotationAdd BLAST71
Domaini277 – 327PWWPPROSITE-ProRule annotationAdd BLAST51

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni75 – 406Interaction with histone H3K14ac1 PublicationAdd BLAST332
Regioni75 – 268Interaction with histone H3K4me01 PublicationAdd BLAST194
Regioni1147 – 1186Interaction with PRKCB1Add BLAST40

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi43 – 47Poly-Lys5
Compositional biasi838 – 854Poly-GlnAdd BLAST17
Compositional biasi1089 – 1092Poly-Ser4

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri88 – 133PHD-typePROSITE-ProRule annotationAdd BLAST46
Zinc fingeri1028 – 1062MYND-typePROSITE-ProRule annotationAdd BLAST35

Keywords - Domaini

Bromodomain, Zinc-finger

Phylogenomic databases

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000154897

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000230951

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9ULU4

Identification of Orthologs from Complete Genome Data

More...
OMAi
NTAYCDY

Database of Orthologous Groups

More...
OrthoDBi
369818at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9ULU4

TreeFam database of animal gene trees

More...
TreeFami
TF317221

Family and domain databases

Conserved Domains Database

More...
CDDi
cd05508 Bromo_RACK7, 1 hit
cd05841 BS69_related, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.20.920.10, 1 hit
3.30.40.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR001487 Bromodomain
IPR036427 Bromodomain-like_sf
IPR000313 PWWP_dom
IPR037967 RACK7_Bromo_dom
IPR019786 Zinc_finger_PHD-type_CS
IPR021931 ZMYND8
IPR035505 ZMYND8/11_PWWP
IPR011011 Znf_FYVE_PHD
IPR002893 Znf_MYND
IPR001965 Znf_PHD
IPR019787 Znf_PHD-finger
IPR013083 Znf_RING/FYVE/PHD

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00439 Bromodomain, 1 hit
PF12064 DUF3544, 1 hit
PF00855 PWWP, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00297 BROMO, 1 hit
SM00249 PHD, 1 hit
SM00293 PWWP, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF47370 SSF47370, 1 hit
SSF57903 SSF57903, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50014 BROMODOMAIN_2, 1 hit
PS50812 PWWP, 1 hit
PS01360 ZF_MYND_1, 1 hit
PS50865 ZF_MYND_2, 1 hit
PS01359 ZF_PHD_1, 1 hit
PS50016 ZF_PHD_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (23+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 23 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 23 described isoforms and 7 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9ULU4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDISTRSKDP GSAERTAQKR KFPSPPHSSN GHSPQDTSTS PIKKKKKPGL
60 70 80 90 100
LNSNNKEQSE LRHGPFYYMK QPLTTDPVDV VPQDGRNDFY CWVCHREGQV
110 120 130 140 150
LCCELCPRVY HAKCLRLTSE PEGDWFCPEC EKITVAECIE TQSKAMTMLT
160 170 180 190 200
IEQLSYLLKF AIQKMKQPGT DAFQKPVPLE QHPDYAEYIF HPMDLCTLEK
210 220 230 240 250
NAKKKMYGCT EAFLADAKWI LHNCIIYNGG NHKLTQIAKV VIKICEHEMN
260 270 280 290 300
EIEVCPECYL AACQKRDNWF CEPCSNPHPL VWAKLKGFPF WPAKALRDKD
310 320 330 340 350
GQVDARFFGQ HDRAWVPINN CYLMSKEIPF SVKKTKSIFN SAMQEMEVYV
360 370 380 390 400
ENIRRKFGVF NYSPFRTPYT PNSQYQMLLD PTNPSAGTAK IDKQEKVKLN
410 420 430 440 450
FDMTASPKIL MSKPVLSGGT GRRISLSDMP RSPMSTNSSV HTGSDVEQDA
460 470 480 490 500
EKKATSSHFS ASEESMDFLD KSTASPASTK TGQAGSLSGS PKPFSPQLSA
510 520 530 540 550
PITTKTDKTS TTGSILNLNL DRSKAEMDLK ELSESVQQQS TPVPLISPKR
560 570 580 590 600
QIRSRFQLNL DKTIESCKAQ LGINEISEDV YTAVEHSDSE DSEKSDSSDS
610 620 630 640 650
EYISDDEQKS KNEPEDTEDK EGCQMDKEPS AVKKKPKPTN PVEIKEELKS
660 670 680 690 700
TSPASEKADP GAVKDKASPE PEKDFSEKAK PSPHPIKDKL KGKDETDSPT
710 720 730 740 750
VHLGLDSDSE SELVIDLGED HSGREGRKNK KEPKEPSPKQ DVVGKTPPST
760 770 780 790 800
TVGSHSPPET PVLTRSSAQT SAAGATATTS TSSTVTVTAP APAATGSPVK
810 820 830 840 850
KQRPLLPKET APAVQRVVWN SSSKFQTSSQ KWHMQKMQRQ QQQQQQQNQQ
860 870 880 890 900
QQPQSSQGTR YQTRQAVKAV QQKEITQSPS TSTITLVTST QSSPLVTSSG
910 920 930 940 950
SMSTLVSSVN ADLPIATASA DVAADIAKYT SKMMDAIKGT MTEIYNDLSK
960 970 980 990 1000
NTTGSTIAEI RRLRIEIEKL QWLHQQELSE MKHNLELTMA EMRQSLEQER
1010 1020 1030 1040 1050
DRLIAEVKKQ LELEKQQAVD ETKKKQWCAN CKKEAIFYCC WNTSYCDYPC
1060 1070 1080 1090 1100
QQAHWPEHMK SCTQSATAPQ QEADAEVNTE TLNKSSQGSS SSTQSAPSET
1110 1120 1130 1140 1150
ASASKEKETS AEKSKESGST LDLSGSRETP SSILLGSNQG SDHSRSNKSS
1160 1170 1180
WSSSDEKRGS TRSDHNTSTS TKSLLPKESR LDTFWD
Note: No experimental confirmation available.
Length:1,186
Mass (Da):131,692
Last modified:November 25, 2002 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iBAE8CDEF240E647A
GO
Isoform 2 (identifier: Q9ULU4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-526: Missing.
     823-869: SKFQTSSQKWHMQKMQRQQQQQQQQNQQQQPQSSQGTRYQTRQAVKA → T

Show »
Length:614
Mass (Da):66,961
Checksum:i8E6EF67059803EF7
GO
Isoform 3 (identifier: Q9ULU4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-145: Missing.
     823-869: SKFQTSSQKWHMQKMQRQQQQQQQQNQQQQPQSSQGTRYQTRQAVKA → T

Show »
Length:995
Mass (Da):109,683
Checksum:i9FE7BB1FB8105F83
GO
Isoform 4 (identifier: Q9ULU4-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-376: Missing.
     823-869: SKFQTSSQKWHMQKMQRQQQQQQQQNQQQQPQSSQGTRYQTRQAVKA → T

Show »
Length:764
Mass (Da):82,691
Checksum:iC403C40DE69E8BB3
GO
Isoform 5 (identifier: Q9ULU4-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MHPQSLAEEEIKTEQEVVEGM
     58-82: Missing.

Show »
Length:1,181
Mass (Da):131,058
Checksum:i03A6396E9A94AD94
GO
Isoform 6 (identifier: Q9ULU4-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-145: Missing.
     823-869: SKFQTSSQKWHMQKMQRQQQQQQQQNQQQQPQSSQGTRYQTRQAVKA → T
     1142-1142: D → VSKRCDKQPAYAPTTTDHQPHPNYPAQKY

Note: No experimental confirmation available.
Show »
Length:1,023
Mass (Da):112,892
Checksum:i37EB9CAA51A856E3
GO
Isoform 7 (identifier: Q9ULU4-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MHPQSLAEEEIKTEQEVVEGM
     1142-1142: D → VSKRCDKQPAYAPTTTDHQPHPNYPAQKY

Show »
Length:1,234
Mass (Da):137,168
Checksum:i10471430CE043C09
GO
Isoform 8 (identifier: Q9ULU4-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MHPQSLAEEEIKTEQEVVEGM
     742-868: Missing.
     1142-1142: D → VSKRCDKQPAYAPTTTDHQPHPNYPAQKY

Show »
Length:1,107
Mass (Da):123,518
Checksum:i3EF5E50B6BAA5800
GO
Isoform 9 (identifier: Q9ULU4-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     823-869: SKFQTSSQKWHMQKMQRQQQQQQQQNQQQQPQSSQGTRYQTRQAVKA → T
     1142-1142: D → VSKRCDKQPAYAPTTTDHQPHPNYPAQKY

Note: No experimental confirmation available.
Show »
Length:1,168
Mass (Da):129,315
Checksum:i871DE79731D3654E
GO
Isoform 10 (identifier: Q9ULU4-10) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MHPQSLAEEEIKTEQEVVEGM

Show »
Length:1,206
Mass (Da):133,958
Checksum:i3CB6DF728E65DE2E
GO
Isoform 11 (identifier: Q9ULU4-11) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1142-1142: D → VSKRCDKQPAYAPTTTDHQPHPNYPAQKY

Show »
Length:1,214
Mass (Da):134,902
Checksum:i6BCD191178126950
GO
Isoform 12 (identifier: Q9ULU4-12) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MHPQSLAEEEIKTEQEVVEGM
     823-869: SKFQTSSQKWHMQKMQRQQQQQQQQNQQQQPQSSQGTRYQTRQAVKA → T

Show »
Length:1,160
Mass (Da):128,371
Checksum:i9780CF6CACFCCC9A
GO
Isoform 13 (identifier: Q9ULU4-13) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MHPQSLAEEEIKTEQEVVEGM
     823-869: SKFQTSSQKWHMQKMQRQQQQQQQQNQQQQPQSSQGTRYQTRQAVKA → T
     1142-1142: D → VSKRCDKQPAYAPTTTDHQPHPNYPAQKY

Show »
Length:1,188
Mass (Da):131,580
Checksum:iC10B9CA76DB23389
GO
Isoform 14 (identifier: Q9ULU4-14) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MHPQSLAEEEIKTEQEVVEGM
     58-82: Missing.
     823-869: SKFQTSSQKWHMQKMQRQQQQQQQQNQQQQPQSSQGTRYQTRQAVKA → T

Show »
Length:1,135
Mass (Da):125,471
Checksum:i0CAAD0AFD252C3A2
GO
Isoform 15 (identifier: Q9ULU4-15) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MHPQSLAEEEIKTEQEVVEGM
     58-82: Missing.
     474-520: Missing.
     823-869: SKFQTSSQKWHMQKMQRQQQQQQQQNQQQQPQSSQGTRYQTRQAVKA → T

Show »
Length:1,088
Mass (Da):120,828
Checksum:i89769DB84068AE00
GO
Isoform 16 (identifier: Q9ULU4-16) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MHPQSLAEEEIKTEQEVVEGM
     58-82: Missing.
     823-869: SKFQTSSQKWHMQKMQRQQQQQQQQNQQQQPQSSQGTRYQTRQAVKA → T
     1142-1142: D → VSKRCDKQPAYAPTTTDHQPHPNYPAQKY

Show »
Length:1,163
Mass (Da):128,680
Checksum:i1BBBE722ED85361C
GO
Isoform 17 (identifier: Q9ULU4-17) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MHPQSLAEEEIKTEQEVVEGM
     58-82: Missing.
     742-868: Missing.

Note: No experimental confirmation available.Combined sources
Show »
Length:1,054
Mass (Da):117,408
Checksum:iC01B7C094F9C970C
GO
Isoform 18 (identifier: Q9ULU4-18) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MHPQSLAEEEIKTEQEVVEGM
     58-82: Missing.
     474-520: Missing.

Note: No experimental confirmation available.Combined sources
Show »
Length:1,134
Mass (Da):126,415
Checksum:i64F9746E9458BB1B
GO
Isoform 19 (identifier: Q9ULU4-19) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MVFLEEFEARSCLAEEEIKTEQEVVEGM
     1142-1142: D → VSKRCDKQPAYAPTTTDHQPHPNYPAQKY

Note: No experimental confirmation available.
Show »
Length:1,241
Mass (Da):138,030
Checksum:i20A285CF0B00832B
GO
Isoform 20 (identifier: Q9ULU4-20) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MFSSLQKSFNLAEEEIKTEQEVVEGM
     58-82: Missing.

Note: No experimental confirmation available.
Show »
Length:1,186
Mass (Da):131,647
Checksum:iD94974DC1C82F30B
GO
Isoform 21 (identifier: Q9ULU4-21) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     58-82: Missing.
     823-869: SKFQTSSQKWHMQKMQRQQQQQQQQNQQQQPQSSQGTRYQTRQAVKA → T

Note: No experimental confirmation available.
Show »
Length:1,115
Mass (Da):123,205
Checksum:i521DADD47EDA30FA
GO
Isoform 22 (identifier: Q9ULU4-22) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MHPQSLAEEEIKTEQEVVEGM
     823-869: SKFQTSSQKWHMQKMQRQQQQQQQQNQQQQPQSSQGTRYQTRQAVKA → T
     933-959: Missing.
     1142-1142: D → VSKRCDKQPAYAPTTTDHQPHPNYPAQKY

Note: Gene prediction based on EST data.Combined sources
Show »
Length:1,161
Mass (Da):128,662
Checksum:iDF2932354478AD04
GO
Isoform 23 (identifier: Q9ULU4-23) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     58-82: Missing.
     132-169: Missing.
     823-869: SKFQTSSQKWHMQKMQRQQQQQQQQNQQQQPQSSQGTRYQTRQAVKA → T
     1142-1142: D → VSKRCDKQPAYAPTTTDHQPHPNYPAQKY

Note: No experimental confirmation available.
Show »
Length:1,105
Mass (Da):122,116
Checksum:i1FC56CEF2DEDD752
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 7 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A087WVZ6A0A087WVZ6_HUMAN
Protein kinase C-binding protein 1
ZMYND8
1,136Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C4X9H7C4X9_HUMAN
Protein kinase C-binding protein 1
ZMYND8
1,095Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WV57A0A087WV57_HUMAN
Protein kinase C-binding protein 1
ZMYND8
767Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WYS3A0A087WYS3_HUMAN
Protein kinase C-binding protein 1
ZMYND8
1,087Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q5TH12Q5TH12_HUMAN
Protein kinase C-binding protein 1
ZMYND8
175Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q5TH08Q5TH08_HUMAN
Protein kinase C-binding protein 1
ZMYND8
42Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q5TH07Q5TH07_HUMAN
Protein kinase C-binding protein 1
ZMYND8
24Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAC72244 differs from that shown. Reason: Frameshift.Curated
The sequence BAA86439 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti119S → P in BAH11794 (PubMed:14702039).Curated1
Sequence conflicti202A → T in BAH12176 (PubMed:14702039).Curated1
Sequence conflicti325S → F in BAH12176 (PubMed:14702039).Curated1
Sequence conflicti391I → V in AAL50790 (PubMed:11149944).Curated1
Sequence conflicti399L → P in BAH11794 (PubMed:14702039).Curated1
Sequence conflicti470D → G in BAH11794 (PubMed:14702039).Curated1
Sequence conflicti874E → G in BAG53824 (PubMed:14702039).Curated1
Sequence conflicti894P → A in AAG34905 (PubMed:11149944).Curated1
Sequence conflicti894P → A in AAL50790 (PubMed:11149944).Curated1
Sequence conflicti967I → T in CAE46008 (PubMed:17974005).Curated1
Isoform 2 (identifier: Q9ULU4-2)
Sequence conflicti297T → S in AAF71262 (PubMed:11003709).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_055559752V → A1 PublicationCorresponds to variant dbSNP:rs2275801Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0005661 – 526Missing in isoform 2. 1 PublicationAdd BLAST526
Alternative sequenceiVSP_0005651 – 376Missing in isoform 4. 1 PublicationAdd BLAST376
Alternative sequenceiVSP_0005641 – 145Missing in isoform 3 and isoform 6. 2 PublicationsAdd BLAST145
Alternative sequenceiVSP_0548101M → MVFLEEFEARSCLAEEEIKT EQEVVEGM in isoform 19. 1 Publication1
Alternative sequenceiVSP_0548111M → MFSSLQKSFNLAEEEIKTEQ EVVEGM in isoform 20. 1 Publication1
Alternative sequenceiVSP_0005631M → MHPQSLAEEEIKTEQEVVEG M in isoform 5, isoform 7, isoform 8, isoform 10, isoform 12, isoform 13, isoform 14, isoform 15, isoform 16, isoform 17, isoform 18 and isoform 22. 3 Publications1
Alternative sequenceiVSP_00056758 – 82Missing in isoform 5, isoform 14, isoform 15, isoform 16, isoform 17, isoform 18, isoform 20, isoform 21 and isoform 23. 3 PublicationsAdd BLAST25
Alternative sequenceiVSP_054812132 – 169Missing in isoform 23. 1 PublicationAdd BLAST38
Alternative sequenceiVSP_053400474 – 520Missing in isoform 15 and isoform 18. 1 PublicationAdd BLAST47
Alternative sequenceiVSP_017096742 – 868Missing in isoform 8 and isoform 17. 2 PublicationsAdd BLAST127
Alternative sequenceiVSP_000568823 – 869SKFQT…QAVKA → T in isoform 2, isoform 3, isoform 4, isoform 6, isoform 9, isoform 12, isoform 13, isoform 14, isoform 15, isoform 16, isoform 21, isoform 22 and isoform 23. 6 PublicationsAdd BLAST47
Alternative sequenceiVSP_054814933 – 959Missing in isoform 22. CuratedAdd BLAST27
Alternative sequenceiVSP_0005701142D → VSKRCDKQPAYAPTTTDHQP HPNYPAQKY in isoform 6, isoform 7, isoform 8, isoform 9, isoform 11, isoform 13, isoform 16, isoform 19, isoform 22 and isoform 23. 5 Publications1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF233453 mRNA Translation: AAF71262.1
U48251 mRNA Translation: AAC72244.1 Frameshift.
AF454056 mRNA Translation: AAL50790.1
AF273045 mRNA Translation: AAG34905.1
DQ082998 mRNA Translation: AAY85630.1
DQ082999 mRNA Translation: AAY85631.1
DQ368669 mRNA Translation: ABC86680.1
DQ368670 mRNA Translation: ABC86681.1
DQ368671 mRNA Translation: ABC86682.1
DQ368672 mRNA Translation: ABC86683.1
DQ368673 mRNA Translation: ABC86684.1
DQ368674 mRNA Translation: ABC86685.1
DQ368677 mRNA Translation: ABC86688.1
DQ368678 mRNA Translation: ABC86689.1
DQ368679 mRNA Translation: ABC86690.1
DQ368680 mRNA Translation: ABC86691.1
AB032951 mRNA Translation: BAA86439.1 Different initiation.
AK122966 mRNA Translation: BAG53824.1
AK294511 mRNA Translation: BAH11794.1
AK295747 mRNA Translation: BAH12176.1
AK299899 mRNA Translation: BAH13166.1
BX641005 mRNA Translation: CAE46008.1
AL031666, AL049540, AL022342 Genomic DNA Translation: CAI21842.1
AL049540, AL031666, AL022342 Genomic DNA Translation: CAI23169.1
AL049540, AL031666, AL390212 Genomic DNA Translation: CAI23168.1
CH471077 Genomic DNA Translation: EAW75703.1
CH471077 Genomic DNA Translation: EAW75706.1
CH471077 Genomic DNA Translation: EAW75709.1
CH471077 Genomic DNA Translation: EAW75711.1
CH471077 Genomic DNA Translation: EAW75712.1
CH471077 Genomic DNA Translation: EAW75715.1
BC030721 mRNA Translation: AAH30721.2
BC136608 mRNA Translation: AAI36609.1
BC144289 mRNA Translation: AAI44290.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS13404.1 [Q9ULU4-12]
CCDS13405.1 [Q9ULU4-13]
CCDS46613.1 [Q9ULU4-14]
CCDS63300.1 [Q9ULU4-11]
CCDS63301.1 [Q9ULU4-9]
CCDS63303.1 [Q9ULU4-18]
CCDS63304.1 [Q9ULU4-17]
CCDS63306.1 [Q9ULU4-7]
CCDS74738.1 [Q9ULU4-20]
CCDS86961.1 [Q9ULU4-1]
CCDS86962.1 [Q9ULU4-19]

NCBI Reference Sequences

More...
RefSeqi
NP_001268700.1, NM_001281771.2 [Q9ULU4-17]
NP_001268701.1, NM_001281772.2 [Q9ULU4-20]
NP_001268702.1, NM_001281773.2 [Q9ULU4-11]
NP_001268703.1, NM_001281774.2 [Q9ULU4-9]
NP_001268704.1, NM_001281775.2 [Q9ULU4-7]
NP_001268705.1, NM_001281776.2 [Q9ULU4-8]
NP_001268706.1, NM_001281777.2 [Q9ULU4-16]
NP_001268707.1, NM_001281778.2 [Q9ULU4-5]
NP_001268710.1, NM_001281781.2 [Q9ULU4-15]
NP_001268711.1, NM_001281782.2
NP_001268712.1, NM_001281783.2 [Q9ULU4-10]
NP_001268713.1, NM_001281784.2 [Q9ULU4-18]
NP_036540.3, NM_012408.5 [Q9ULU4-12]
NP_898868.1, NM_183047.3 [Q9ULU4-13]
NP_898869.1, NM_183048.3 [Q9ULU4-14]
XP_005260413.1, XM_005260356.4
XP_005260417.1, XM_005260360.4
XP_005260423.1, XM_005260366.2
XP_006723825.1, XM_006723762.3
XP_011527053.1, XM_011528751.1
XP_016883250.1, XM_017027761.1
XP_016883256.1, XM_017027767.1
XP_016883257.1, XM_017027768.1

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000262975; ENSP00000262975; ENSG00000101040 [Q9ULU4-9]
ENST00000311275; ENSP00000312237; ENSG00000101040 [Q9ULU4-1]
ENST00000352431; ENSP00000335537; ENSG00000101040 [Q9ULU4-12]
ENST00000355972; ENSP00000348246; ENSG00000101040 [Q9ULU4-11]
ENST00000360911; ENSP00000354166; ENSG00000101040 [Q9ULU4-14]
ENST00000372023; ENSP00000361093; ENSG00000101040 [Q9ULU4-23]
ENST00000396281; ENSP00000379577; ENSG00000101040 [Q9ULU4-20]
ENST00000446994; ENSP00000396725; ENSG00000101040 [Q9ULU4-11]
ENST00000458360; ENSP00000392964; ENSG00000101040 [Q9ULU4-17]
ENST00000461685; ENSP00000418210; ENSG00000101040 [Q9ULU4-13]
ENST00000471951; ENSP00000420095; ENSG00000101040 [Q9ULU4-7]
ENST00000536340; ENSP00000439800; ENSG00000101040 [Q9ULU4-19]
ENST00000540497; ENSP00000443086; ENSG00000101040 [Q9ULU4-18]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
23613

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:23613

UCSC genome browser

More...
UCSCi
uc002xss.3 human [Q9ULU4-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF233453 mRNA Translation: AAF71262.1
U48251 mRNA Translation: AAC72244.1 Frameshift.
AF454056 mRNA Translation: AAL50790.1
AF273045 mRNA Translation: AAG34905.1
DQ082998 mRNA Translation: AAY85630.1
DQ082999 mRNA Translation: AAY85631.1
DQ368669 mRNA Translation: ABC86680.1
DQ368670 mRNA Translation: ABC86681.1
DQ368671 mRNA Translation: ABC86682.1
DQ368672 mRNA Translation: ABC86683.1
DQ368673 mRNA Translation: ABC86684.1
DQ368674 mRNA Translation: ABC86685.1
DQ368677 mRNA Translation: ABC86688.1
DQ368678 mRNA Translation: ABC86689.1
DQ368679 mRNA Translation: ABC86690.1
DQ368680 mRNA Translation: ABC86691.1
AB032951 mRNA Translation: BAA86439.1 Different initiation.
AK122966 mRNA Translation: BAG53824.1
AK294511 mRNA Translation: BAH11794.1
AK295747 mRNA Translation: BAH12176.1
AK299899 mRNA Translation: BAH13166.1
BX641005 mRNA Translation: CAE46008.1
AL031666, AL049540, AL022342 Genomic DNA Translation: CAI21842.1
AL049540, AL031666, AL022342 Genomic DNA Translation: CAI23169.1
AL049540, AL031666, AL390212 Genomic DNA Translation: CAI23168.1
CH471077 Genomic DNA Translation: EAW75703.1
CH471077 Genomic DNA Translation: EAW75706.1
CH471077 Genomic DNA Translation: EAW75709.1
CH471077 Genomic DNA Translation: EAW75711.1
CH471077 Genomic DNA Translation: EAW75712.1
CH471077 Genomic DNA Translation: EAW75715.1
BC030721 mRNA Translation: AAH30721.2
BC136608 mRNA Translation: AAI36609.1
BC144289 mRNA Translation: AAI44290.1
CCDSiCCDS13404.1 [Q9ULU4-12]
CCDS13405.1 [Q9ULU4-13]
CCDS46613.1 [Q9ULU4-14]
CCDS63300.1 [Q9ULU4-11]
CCDS63301.1 [Q9ULU4-9]
CCDS63303.1 [Q9ULU4-18]
CCDS63304.1 [Q9ULU4-17]
CCDS63306.1 [Q9ULU4-7]
CCDS74738.1 [Q9ULU4-20]
CCDS86961.1 [Q9ULU4-1]
CCDS86962.1 [Q9ULU4-19]
RefSeqiNP_001268700.1, NM_001281771.2 [Q9ULU4-17]
NP_001268701.1, NM_001281772.2 [Q9ULU4-20]
NP_001268702.1, NM_001281773.2 [Q9ULU4-11]
NP_001268703.1, NM_001281774.2 [Q9ULU4-9]
NP_001268704.1, NM_001281775.2 [Q9ULU4-7]
NP_001268705.1, NM_001281776.2 [Q9ULU4-8]
NP_001268706.1, NM_001281777.2 [Q9ULU4-16]
NP_001268707.1, NM_001281778.2 [Q9ULU4-5]
NP_001268710.1, NM_001281781.2 [Q9ULU4-15]
NP_001268711.1, NM_001281782.2
NP_001268712.1, NM_001281783.2 [Q9ULU4-10]
NP_001268713.1, NM_001281784.2 [Q9ULU4-18]
NP_036540.3, NM_012408.5 [Q9ULU4-12]
NP_898868.1, NM_183047.3 [Q9ULU4-13]
NP_898869.1, NM_183048.3 [Q9ULU4-14]
XP_005260413.1, XM_005260356.4
XP_005260417.1, XM_005260360.4
XP_005260423.1, XM_005260366.2
XP_006723825.1, XM_006723762.3
XP_011527053.1, XM_011528751.1
XP_016883250.1, XM_017027761.1
XP_016883256.1, XM_017027767.1
XP_016883257.1, XM_017027768.1

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4COSX-ray1.67A83-406[»]
5B73X-ray1.80A73-406[»]
5MQ4X-ray2.70A/B/C/D/E/F949-1073[»]
5Y1ZX-ray2.68C/D83-406[»]
SMRiQ9ULU4
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGridi117146, 70 interactors
IntActiQ9ULU4, 52 interactors
MINTiQ9ULU4
STRINGi9606.ENSP00000420095

Chemistry databases

BindingDBiQ9ULU4
ChEMBLiCHEMBL3627580

PTM databases

iPTMnetiQ9ULU4
PhosphoSitePlusiQ9ULU4

Polymorphism and mutation databases

BioMutaiZMYND8
DMDMi25453223

Proteomic databases

EPDiQ9ULU4
jPOSTiQ9ULU4
MassIVEiQ9ULU4
PeptideAtlasiQ9ULU4
PRIDEiQ9ULU4
ProteomicsDBi25473
44416
61294
61295
7246
85109 [Q9ULU4-1]
85110 [Q9ULU4-10]
85111 [Q9ULU4-11]
85112 [Q9ULU4-12]
85113 [Q9ULU4-13]
85114 [Q9ULU4-14]
85115 [Q9ULU4-2]
85116 [Q9ULU4-3]
85117 [Q9ULU4-4]
85118 [Q9ULU4-5]
85119 [Q9ULU4-6]
85120 [Q9ULU4-7]
85121 [Q9ULU4-8]
85122 [Q9ULU4-9]

Genome annotation databases

EnsembliENST00000262975; ENSP00000262975; ENSG00000101040 [Q9ULU4-9]
ENST00000311275; ENSP00000312237; ENSG00000101040 [Q9ULU4-1]
ENST00000352431; ENSP00000335537; ENSG00000101040 [Q9ULU4-12]
ENST00000355972; ENSP00000348246; ENSG00000101040 [Q9ULU4-11]
ENST00000360911; ENSP00000354166; ENSG00000101040 [Q9ULU4-14]
ENST00000372023; ENSP00000361093; ENSG00000101040 [Q9ULU4-23]
ENST00000396281; ENSP00000379577; ENSG00000101040 [Q9ULU4-20]
ENST00000446994; ENSP00000396725; ENSG00000101040 [Q9ULU4-11]
ENST00000458360; ENSP00000392964; ENSG00000101040 [Q9ULU4-17]
ENST00000461685; ENSP00000418210; ENSG00000101040 [Q9ULU4-13]
ENST00000471951; ENSP00000420095; ENSG00000101040 [Q9ULU4-7]
ENST00000536340; ENSP00000439800; ENSG00000101040 [Q9ULU4-19]
ENST00000540497; ENSP00000443086; ENSG00000101040 [Q9ULU4-18]
GeneIDi23613
KEGGihsa:23613
UCSCiuc002xss.3 human [Q9ULU4-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
23613
DisGeNETi23613

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ZMYND8
HGNCiHGNC:9397 ZMYND8
HPAiHPA020949
neXtProtiNX_Q9ULU4
OpenTargetsiENSG00000101040
PharmGKBiPA162409890

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

GeneTreeiENSGT00940000154897
HOGENOMiHOG000230951
InParanoidiQ9ULU4
OMAiNTAYCDY
OrthoDBi369818at2759
PhylomeDBiQ9ULU4
TreeFamiTF317221

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
ZMYND8 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
ZMYND8

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
23613
PharosiQ9ULU4

Protein Ontology

More...
PROi
PR:Q9ULU4

Gene expression databases

BgeeiENSG00000101040 Expressed in 247 organ(s), highest expression level in caput epididymis
ExpressionAtlasiQ9ULU4 baseline and differential
GenevisibleiQ9ULU4 HS

Family and domain databases

CDDicd05508 Bromo_RACK7, 1 hit
cd05841 BS69_related, 1 hit
Gene3Di1.20.920.10, 1 hit
3.30.40.10, 1 hit
InterProiView protein in InterPro
IPR001487 Bromodomain
IPR036427 Bromodomain-like_sf
IPR000313 PWWP_dom
IPR037967 RACK7_Bromo_dom
IPR019786 Zinc_finger_PHD-type_CS
IPR021931 ZMYND8
IPR035505 ZMYND8/11_PWWP
IPR011011 Znf_FYVE_PHD
IPR002893 Znf_MYND
IPR001965 Znf_PHD
IPR019787 Znf_PHD-finger
IPR013083 Znf_RING/FYVE/PHD
PfamiView protein in Pfam
PF00439 Bromodomain, 1 hit
PF12064 DUF3544, 1 hit
PF00855 PWWP, 1 hit
SMARTiView protein in SMART
SM00297 BROMO, 1 hit
SM00249 PHD, 1 hit
SM00293 PWWP, 1 hit
SUPFAMiSSF47370 SSF47370, 1 hit
SSF57903 SSF57903, 1 hit
PROSITEiView protein in PROSITE
PS50014 BROMODOMAIN_2, 1 hit
PS50812 PWWP, 1 hit
PS01360 ZF_MYND_1, 1 hit
PS50865 ZF_MYND_2, 1 hit
PS01359 ZF_PHD_1, 1 hit
PS50016 ZF_PHD_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPKCB1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9ULU4
Secondary accession number(s): B3KVL2
, B7Z2A8, B7Z3E0, B7Z680, B7ZM62, E1P5U5, F5H0X3, H7C0U2, J3KPU3, Q13517, Q2HXV1, Q2HXV2, Q2HXV3, Q2HXV4, Q2HXV7, Q2HXV8, Q2HXV9, Q2HXW0, Q2HXW1, Q2HXW2, Q4JJ94, Q4JJ95, Q5TH09, Q5TH11, Q6MZM1, Q8WXC5, Q9H1F3, Q9H1F4, Q9H1F5, Q9H1L8, Q9H1L9, Q9H2G5, Q9NYN3, Q9UIX6
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 25, 2002
Last sequence update: November 25, 2002
Last modified: November 13, 2019
This is version 189 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 20
    Human chromosome 20: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again