Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
The new UniProt website is here! Take me to UniProt BETA

UniProtKB - Q9ULP0 (NDRG4_HUMAN)

Entry version 173 (25 May 2022)
Sequence version 2 (23 Jan 2002)
Previous versions | rss
Add a publicationFeedback
Protein

Protein NDRG4

Gene

NDRG4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Contributes to the maintenance of intracerebral BDNF levels within the normal range, which is necessary for the preservation of spatial learning and the resistance to neuronal cell death caused by ischemic stress (By similarity).

May enhance growth factor-induced ERK1 and ERK2 phosphorylation, including that induced by PDGF and FGF. May attenuate NGF-promoted ELK1 phosphorylation in a microtubule-dependent manner.

By similarity1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

Complete GO annotation on QuickGO ...

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q9ULP0

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...SignaLinki		Q9ULP0

Protein family/group databases

ESTHER database of the Alpha/Beta-hydrolase fold superfamily of proteins

More...ESTHERi		human-NDRG4, Ndr_family

MEROPS protease database

More...MEROPSi		S33.986

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Protein NDRG4
Alternative name(s):
Brain development-related molecule 1
N-myc downstream-regulated gene 4 protein
Vascular smooth muscle cell-associated protein 8
Short name:
SMAP-8
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:NDRG4
Synonyms:BDM1, KIAA1180
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 16

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:14466, NDRG4

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		614463, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q9ULP0

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000103034

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cytoplasm

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		65009

Open Targets

More...OpenTargetsi		ENSG00000103034

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA31485

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q9ULP0, Tbio

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		NDRG4

Domain mapping of disease mutations (DMDM)

More...DMDMi		20141614

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001595791 – 352Protein NDRG4Add BLAST352

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei298PhosphoserineBy similarity1
Modified residuei317PhosphoserineBy similarity1
Modified residuei323PhosphoserineBy similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated in an aortic smooth muscle cell line, following PDGF treatment.1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q9ULP0

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q9ULP0

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q9ULP0

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q9ULP0

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q9ULP0

PeptideAtlas

More...PeptideAtlasi		Q9ULP0

PRoteomics IDEntifications database

More...PRIDEi		Q9ULP0

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		4431
46171
85084 [Q9ULP0-1]
85085 [Q9ULP0-2]
85086 [Q9ULP0-3]
85087 [Q9ULP0-4]
85088 [Q9ULP0-5]
85089 [Q9ULP0-6]

Consortium for Top Down Proteomics

More...TopDownProteomicsi		Q9ULP0-3 [Q9ULP0-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q9ULP0

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q9ULP0

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed predominantly in brain and heart (at protein level). In the brain, detected in astrocytes. Isoform 1 and isoform 2 are only expressed in brain. Isoform 3 is expressed in both heart and brain. Up-regulated in glioblastoma multiforme cells.3 Publications

<p>This subsection of the 'Expression' section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified 'at the protein level'.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Expressed in a cell cycle-specific manner in glioblastoma multiple cells. Low levels in G2/M cells increase with progression through G1 phase and entry and progression through S phase.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000103034, Expressed in anterior cingulate cortex and 203 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q9ULP0, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q9ULP0, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000103034, Tissue enhanced (brain, heart muscle)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details
Q9ULP0
With#Exp.IntAct
AGTRAP [Q6RW13]3EBI-10323810,EBI-741181
ARL6IP1 [Q15041]3EBI-10323810,EBI-714543
CMTM5 [Q96DZ9]3EBI-10323810,EBI-2548702
RABAC1 [Q9UI14]3EBI-10323810,EBI-712367
Isoform 2 [Q9ULP0-2]
With#Exp.IntAct
AGTRAP - isoform 2 [Q6RW13-2]6EBI-11978907,EBI-11522760
ARFIP2 [P53365]3EBI-11978907,EBI-638194
ARL6IP1 [Q15041]3EBI-11978907,EBI-714543
ATP5PF [P18859]3EBI-11978907,EBI-2606700
CACFD1 [Q9UGQ2]3EBI-11978907,EBI-8652492
CDR1 [P51861]3EBI-11978907,EBI-2836538
CIDEB [Q9UHD4]3EBI-11978907,EBI-7062247
CMTM5 - isoform 2 [Q96DZ9-2]7EBI-11978907,EBI-11522780
COQ3 [Q9NZJ6]3EBI-11978907,EBI-10897372
CPLX2 [Q6PUV4]3EBI-11978907,EBI-2689453
DDIT4L [Q96D03]3EBI-11978907,EBI-742054
DERL3 [Q96Q80]3EBI-11978907,EBI-12831318
DGAT2L6 [Q6ZPD8]3EBI-11978907,EBI-12831978
ERGIC3 [Q9Y282]3EBI-11978907,EBI-781551
LEUTX [A8MZ59]3EBI-11978907,EBI-17490413
LIME1 [Q9H400]3EBI-11978907,EBI-2830566
LRRC59 [Q96AG4]3EBI-11978907,EBI-358888
MAL2 [Q969L2]8EBI-11978907,EBI-944295
MTIF3 [Q9H2K0]3EBI-11978907,EBI-3923617
PLP2 [Q04941]3EBI-11978907,EBI-608347
PRAF2 [O60831]3EBI-11978907,EBI-2506064
RABAC1 [Q9UI14]3EBI-11978907,EBI-712367
REEP6 - isoform 2 [Q96HR9-2]7EBI-11978907,EBI-14065960
RHBDD2 - isoform 3 [Q6NTF9-3]3EBI-11978907,EBI-17589229
RTN3 - isoform 3 [O95197-3]3EBI-11978907,EBI-11525735
SCAMP1 [O15126]3EBI-11978907,EBI-954338
SDR16C5 [Q8N3Y7]3EBI-11978907,EBI-3923480
SFT2D1 [Q8WV19]3EBI-11978907,EBI-2854842
SFT2D2 [O95562]3EBI-11978907,EBI-4402330
SGK1 [O00141]3EBI-11978907,EBI-1042854
SIN3A [H3BQL7]3EBI-11978907,EBI-13384308
SMPD2 [O60906]3EBI-11978907,EBI-12828299
SYNGR1 - isoform 1B [O43759-2]3EBI-11978907,EBI-12187159
SYNGR3 [O43761]3EBI-11978907,EBI-11321949
SYP [P08247]3EBI-11978907,EBI-9071725
THAP4 [Q8WY91]3EBI-11978907,EBI-726691
TMEM208 [Q9BTX3]3EBI-11978907,EBI-12876824
YIF1A [O95070]3EBI-11978907,EBI-2799703

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		122372, 52 interactors

Protein interaction database and analysis system

More...IntActi		Q9ULP0, 45 interactors

Molecular INTeraction database

More...MINTi		Q9ULP0

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000377823

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q9ULP0, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

AlphaFold Protein Structure Database

More...AlphaFoldDBi		Q9ULP0

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q9ULP0

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni314 – 352DisorderedSequence analysisAdd BLAST39

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the NDRG family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG2931, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00950000182872

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_035361_1_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q9ULP0

Identification of Orthologs from Complete Genome Data

More...OMAi		CMADSGG

Database of Orthologous Groups

More...OrthoDBi		854690at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q9ULP0

TreeFam database of animal gene trees

More...TreeFami		TF313168

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		3.40.50.1820, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR029058, AB_hydrolase
IPR004142, NDRG
IPR030695, NDRG4

The PANTHER Classification System

More...PANTHERi		PTHR11034, PTHR11034, 1 hit
PTHR11034:SF21, PTHR11034:SF21, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF03096, Ndr, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF53474, SSF53474, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (8+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 8 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 8 described isoforms and 31 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9ULP0-1) [UniParc]FASTAAdd to basket
Also known as: NDRG4-BVar

This isoform has been chosen as the <p><strong>What is the canonical sequence?</strong><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPECWDGEHD IETPYGLLHV VIRGSPKGNR PAILTYHDVG LNHKLCFNTF 
        60         70         80         90        100
FNFEDMQEIT KHFVVCHVDA PGQQVGASQF PQGYQFPSME QLAAMLPSVV 
       110        120        130        140        150
QHFGFKYVIG IGVGAGAYVL AKFALIFPDL VEGLVLVNID PNGKGWIDWA 
       160        170        180        190        200
ATKLSGLTST LPDTVLSHLF SQEELVNNTE LVQSYRQQIG NVVNQANLQL 
       210        220        230        240        250
FWNMYNSRRD LDINRPGTVP NAKTLRCPVM LVVGDNAPAE DGVVECNSKL 
       260        270        280        290        300
DPTTTTFLKM ADSGGLPQVT QPGKLTEAFK YFLQGMGYIA YLKDRRLSGG 
       310        320        330        340        350
AVPSASMTRL ARSRTASLTS ASSVDGSRPQ ACTHSESSEG LGQVNHTMEV 

SC
Length:352
Mass (Da):38,459
Last modified:January 23, 2002 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i4CFAFC7C820013B6
GO
Isoform 2 (identifier: Q9ULP0-2) [UniParc]FASTAAdd to basket
Also known as: NDRG4-B

The sequence of this isoform differs from the canonical sequence as follows:
     289-302: IAYLKDRRLSGGAV → M

Show »
Length:339
Mass (Da):37,089
Checksum:iE5721D653F9CF056
GO
Isoform 3 (identifier: Q9ULP0-3) [UniParc]FASTAAdd to basket
Also known as: NDRG4-H

The sequence of this isoform differs from the canonical sequence as follows:
     1-7: MPECWDG → MAGLQELRFPEEKPLLRGQDATELESSDAFLLAADTDWK
     289-302: IAYLKDRRLSGGAV → M

Show »
Length:371
Mass (Da):40,645
Checksum:iF7E4FA067E0DD752
GO
Isoform 4 (identifier: Q9ULP0-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     291-303: Missing.

Show »
Length:339
Mass (Da):37,045
Checksum:iE56FB113F95D3056
GO
Isoform 5 (identifier: Q9ULP0-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     43-43: H → RKCSPASVSPPLPPISQSD
     289-302: IAYLKDRRLSGGAV → M

Show »
Length:357
Mass (Da):38,900
Checksum:i80425B23A100DEEB
GO
Isoform 6 (identifier: Q9ULP0-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-7: MPECWDG → MKVLGHRLELLTGLLLHDVTMAGLQELRFPEEKPLLRGQDATELESSDAFLLAADTDWK
     289-302: IAYLKDRRLSGGAV → M

Show »
Length:391
Mass (Da):42,886
Checksum:i2072323C9172C2E3
GO
Isoform 7 (identifier: Q9ULP0-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     7-7: G → GVGEGNAGAVKLAGLGDPRWSPGHLLSPGHQ
     289-302: IAYLKDRRLSGGAV → M

Show »
Length:369
Mass (Da):40,049
Checksum:i7DD24F9D2E46FDAE
GO
Isoform 8 (identifier: Q9ULP0-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     7-7: G → GRSQERRLPRVSSTVSPLQ
     289-302: IAYLKDRRLSGGAV → M

Show »
Length:357
Mass (Da):39,168
Checksum:i2CA4F68CC3298268
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 31 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H3BQ01H3BQ01_HUMAN
Protein NDRG4
NDRG4
83Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B7Z9X4B7Z9X4_HUMAN
Protein NDRG4
NDRG4
284Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BQJ4H3BQJ4_HUMAN
Protein NDRG4
NDRG4
327Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BU08H3BU08_HUMAN
Protein NDRG4
NDRG4
143Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BU25H3BU25_HUMAN
Protein NDRG4
NDRG4
128Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BM83H3BM83_HUMAN
Protein NDRG4
NDRG4
84Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BMR6H3BMR6_HUMAN
Protein NDRG4
NDRG4
149Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BN53H3BN53_HUMAN
Protein NDRG4
NDRG4
145Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BNE7H3BNE7_HUMAN
Protein NDRG4
NDRG4
191Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BQ86H3BQ86_HUMAN
Protein NDRG4
NDRG4
173Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There are more potential isoformsShow all

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAA86494 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti10D → N in BAG61777 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0034211 – 7MPECWDG → MAGLQELRFPEEKPLLRGQD ATELESSDAFLLAADTDWK in isoform 3. 1 Publication7
Alternative sequenceiVSP_0229561 – 7MPECWDG → MKVLGHRLELLTGLLLHDVT MAGLQELRFPEEKPLLRGQD ATELESSDAFLLAADTDWK in isoform 6. 1 Publication7
Alternative sequenceiVSP_0458307G → GVGEGNAGAVKLAGLGDPRW SPGHLLSPGHQ in isoform 7. 1 Publication1
Alternative sequenceiVSP_0463267G → GRSQERRLPRVSSTVSPLQ in isoform 8. 1 Publication1
Alternative sequenceiVSP_02295743H → RKCSPASVSPPLPPISQSD in isoform 5. 1 Publication1
Alternative sequenceiVSP_003422289 – 302IAYLK…SGGAV → M in isoform 2, isoform 3, isoform 5, isoform 6, isoform 7 and isoform 8. 4 PublicationsAdd BLAST14
Alternative sequenceiVSP_003423291 – 303Missing in isoform 4. 1 PublicationAdd BLAST13

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AB044947 Genomic DNA Translation: BAB20071.1
AB044947 Genomic DNA Translation: BAB20072.1
AB044947 Genomic DNA Translation: BAB20073.1
AB044944 mRNA Translation: BAB20068.1
AB044945 mRNA Translation: BAB20069.1
AB044946 mRNA Translation: BAB20070.1
AF308608 mRNA Translation: AAL08806.1
AB021172 mRNA Translation: BAB20288.1
AL136584 mRNA Translation: CAB66519.1
AK055038 mRNA Translation: BAG51454.1
AK126574 mRNA Translation: BAC86600.1
AK131248 mRNA Translation: BAD18428.1
AK296415 mRNA Translation: BAG59078.1
AK299949 mRNA Translation: BAG61777.1
AC009118 Genomic DNA No translation available.
BC011795 mRNA Translation: AAH11795.1
AB033006 mRNA Translation: BAA86494.2 Different initiation.

The Consensus CDS (CCDS) project

More...CCDSi		CCDS10797.1 [Q9ULP0-3]
CCDS45500.1 [Q9ULP0-6]
CCDS55999.1 [Q9ULP0-7]
CCDS58465.1 [Q9ULP0-8]
CCDS58466.1 [Q9ULP0-1]
CCDS58467.1 [Q9ULP0-2]

NCBI Reference Sequences

More...RefSeqi		NP_001123959.1, NM_001130487.1 [Q9ULP0-6]
NP_001229762.1, NM_001242833.1 [Q9ULP0-7]
NP_001229763.1, NM_001242834.1 [Q9ULP0-8]
NP_001229764.1, NM_001242835.1 [Q9ULP0-1]
NP_001229765.1, NM_001242836.1 [Q9ULP0-2]
NP_065198.1, NM_020465.3 [Q9ULP0-3]
NP_075061.1, NM_022910.3 [Q9ULP0-3]
XP_016879079.1, XM_017023590.1

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000258187.9; ENSP00000258187.5; ENSG00000103034.15 [Q9ULP0-3]
ENST00000356752.8; ENSP00000349193.4; ENSG00000103034.15 [Q9ULP0-7]
ENST00000394279.6; ENSP00000377820.2; ENSG00000103034.15 [Q9ULP0-3]
ENST00000394282.8; ENSP00000377823.4; ENSG00000103034.15 [Q9ULP0-6]
ENST00000563799.5; ENSP00000458113.1; ENSG00000103034.15 [Q9ULP0-5]
ENST00000566192.5; ENSP00000454410.1; ENSG00000103034.15 [Q9ULP0-2]
ENST00000568640.5; ENSP00000456338.1; ENSG00000103034.15 [Q9ULP0-8]
ENST00000570248.6; ENSP00000457659.1; ENSG00000103034.15

Database of genes from NCBI RefSeq genomes

More...GeneIDi		65009

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:65009

Matched Annotation from NCBI and EMBL-EBI (MANE) - Phase one

More...MANE-Selecti		ENST00000570248.6; ENSP00000457659.1; NM_001242835.2; NP_001229764.1

UCSC genome browser

More...UCSCi		uc002enk.4, human [Q9ULP0-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB044947 Genomic DNA Translation: BAB20071.1
AB044947 Genomic DNA Translation: BAB20072.1
AB044947 Genomic DNA Translation: BAB20073.1
AB044944 mRNA Translation: BAB20068.1
AB044945 mRNA Translation: BAB20069.1
AB044946 mRNA Translation: BAB20070.1
AF308608 mRNA Translation: AAL08806.1
AB021172 mRNA Translation: BAB20288.1
AL136584 mRNA Translation: CAB66519.1
AK055038 mRNA Translation: BAG51454.1
AK126574 mRNA Translation: BAC86600.1
AK131248 mRNA Translation: BAD18428.1
AK296415 mRNA Translation: BAG59078.1
AK299949 mRNA Translation: BAG61777.1
AC009118 Genomic DNA No translation available.
BC011795 mRNA Translation: AAH11795.1
AB033006 mRNA Translation: BAA86494.2 Different initiation.
CCDSiCCDS10797.1 [Q9ULP0-3]
CCDS45500.1 [Q9ULP0-6]
CCDS55999.1 [Q9ULP0-7]
CCDS58465.1 [Q9ULP0-8]
CCDS58466.1 [Q9ULP0-1]
CCDS58467.1 [Q9ULP0-2]
RefSeqiNP_001123959.1, NM_001130487.1 [Q9ULP0-6]
NP_001229762.1, NM_001242833.1 [Q9ULP0-7]
NP_001229763.1, NM_001242834.1 [Q9ULP0-8]
NP_001229764.1, NM_001242835.1 [Q9ULP0-1]
NP_001229765.1, NM_001242836.1 [Q9ULP0-2]
NP_065198.1, NM_020465.3 [Q9ULP0-3]
NP_075061.1, NM_022910.3 [Q9ULP0-3]
XP_016879079.1, XM_017023590.1

3D structure databases

AlphaFoldDBiQ9ULP0
SMRiQ9ULP0
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi122372, 52 interactors
IntActiQ9ULP0, 45 interactors
MINTiQ9ULP0
STRINGi9606.ENSP00000377823

Protein family/group databases

ESTHERihuman-NDRG4, Ndr_family
MEROPSiS33.986

PTM databases

iPTMnetiQ9ULP0
PhosphoSitePlusiQ9ULP0

Genetic variation databases

BioMutaiNDRG4
DMDMi20141614

Proteomic databases

EPDiQ9ULP0
jPOSTiQ9ULP0
MassIVEiQ9ULP0
MaxQBiQ9ULP0
PaxDbiQ9ULP0
PeptideAtlasiQ9ULP0
PRIDEiQ9ULP0
ProteomicsDBi4431
46171
85084 [Q9ULP0-1]
85085 [Q9ULP0-2]
85086 [Q9ULP0-3]
85087 [Q9ULP0-4]
85088 [Q9ULP0-5]
85089 [Q9ULP0-6]
TopDownProteomicsiQ9ULP0-3 [Q9ULP0-3]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		2919, 300 antibodies from 33 providers

The DNASU plasmid repository

More...DNASUi		65009

Genome annotation databases

EnsembliENST00000258187.9; ENSP00000258187.5; ENSG00000103034.15 [Q9ULP0-3]
ENST00000356752.8; ENSP00000349193.4; ENSG00000103034.15 [Q9ULP0-7]
ENST00000394279.6; ENSP00000377820.2; ENSG00000103034.15 [Q9ULP0-3]
ENST00000394282.8; ENSP00000377823.4; ENSG00000103034.15 [Q9ULP0-6]
ENST00000563799.5; ENSP00000458113.1; ENSG00000103034.15 [Q9ULP0-5]
ENST00000566192.5; ENSP00000454410.1; ENSG00000103034.15 [Q9ULP0-2]
ENST00000568640.5; ENSP00000456338.1; ENSG00000103034.15 [Q9ULP0-8]
ENST00000570248.6; ENSP00000457659.1; ENSG00000103034.15
GeneIDi65009
KEGGihsa:65009
MANE-SelectiENST00000570248.6; ENSP00000457659.1; NM_001242835.2; NP_001229764.1
UCSCiuc002enk.4, human [Q9ULP0-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		65009
DisGeNETi65009

GeneCards: human genes, protein and diseases

More...GeneCardsi		NDRG4
HGNCiHGNC:14466, NDRG4
HPAiENSG00000103034, Tissue enhanced (brain, heart muscle)
MIMi614463, gene
neXtProtiNX_Q9ULP0
OpenTargetsiENSG00000103034
PharmGKBiPA31485
VEuPathDBiHostDB:ENSG00000103034

Human Unidentified Gene-Encoded large proteins database

More...HUGEi		Search...

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG2931, Eukaryota
GeneTreeiENSGT00950000182872
HOGENOMiCLU_035361_1_0_1
InParanoidiQ9ULP0
OMAiCMADSGG
OrthoDBi854690at2759
PhylomeDBiQ9ULP0
TreeFamiTF313168

Enzyme and pathway databases

PathwayCommonsiQ9ULP0
SignaLinkiQ9ULP0

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		65009, 8 hits in 1073 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		NDRG4, human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		NDRG4

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		65009
PharosiQ9ULP0, Tbio

Protein Ontology

More...PROi		PR:Q9ULP0
RNActiQ9ULP0, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000103034, Expressed in anterior cingulate cortex and 203 other tissues
ExpressionAtlasiQ9ULP0, baseline and differential
GenevisibleiQ9ULP0, HS

Family and domain databases

Gene3Di3.40.50.1820, 1 hit
InterProiView protein in InterPro
IPR029058, AB_hydrolase
IPR004142, NDRG
IPR030695, NDRG4
PANTHERiPTHR11034, PTHR11034, 1 hit
PTHR11034:SF21, PTHR11034:SF21, 1 hit
PfamiView protein in Pfam
PF03096, Ndr, 1 hit
SUPFAMiSSF53474, SSF53474, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiNDRG4_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9ULP0
Secondary accession number(s): B3KNU2
, B4DK66, B4DSW5, H7C600, Q6ZNE7, Q6ZTI7, Q96PL9, Q9GZM1, Q9GZN3, Q9GZX0
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: January 23, 2002
Last modified: May 25, 2022
This is version 173 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again