Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein NDRG4

Gene

NDRG4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Contributes to the maintenance of intracerebral BDNF levels within the normal range, which is necessary for the preservation of spatial learning and the resistance to neuronal cell death caused by ischemic stress (By similarity). May enhance growth factor-induced ERK1 and ERK2 phosphorylation, including that induced by PDGF and FGF. May attenuate NGF-promoted ELK1 phosphorylation in a microtubule-dependent manner.By similarity1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

Protein family/group databases

ESTHER database of the Alpha/Beta-hydrolase fold superfamily of proteins

More...
ESTHERi
human-NDRG4 Ndr_family

MEROPS protease database

More...
MEROPSi
S33.986

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Protein NDRG4
Alternative name(s):
Brain development-related molecule 1
N-myc downstream-regulated gene 4 protein
Vascular smooth muscle cell-associated protein 8
Short name:
SMAP-8
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:NDRG4
Synonyms:BDM1, KIAA1180
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 16

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000103034.14

Human Gene Nomenclature Database

More...
HGNCi
HGNC:14466 NDRG4

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
614463 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9ULP0

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cytoplasm

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
65009

Open Targets

More...
OpenTargetsi
ENSG00000103034

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA31485

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
NDRG4

Domain mapping of disease mutations (DMDM)

More...
DMDMi
20141614

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001595791 – 352Protein NDRG4Add BLAST352

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei298PhosphoserineBy similarity1
Modified residuei317PhosphoserineBy similarity1
Modified residuei323PhosphoserineBy similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated in an aortic smooth muscle cell line, following PDGF treatment.1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9ULP0

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9ULP0

PeptideAtlas

More...
PeptideAtlasi
Q9ULP0

PRoteomics IDEntifications database

More...
PRIDEi
Q9ULP0

ProteomicsDB human proteome resource

More...
ProteomicsDBi
85084
85085 [Q9ULP0-2]
85086 [Q9ULP0-3]
85087 [Q9ULP0-4]
85088 [Q9ULP0-5]
85089 [Q9ULP0-6]

Consortium for Top Down Proteomics

More...
TopDownProteomicsi
Q9ULP0-3 [Q9ULP0-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9ULP0

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9ULP0

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed predominantly in brain and heart (at protein level). In the brain, detected in astrocytes. Isoform 1 and isoform 2 are only expressed in brain. Isoform 3 is expressed in both heart and brain. Up-regulated in glioblastoma multiforme cells.3 Publications

<p>This subsection of the ‘Expression’ section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified ‘at the protein level’.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Expressed in a cell cycle-specific manner in glioblastoma multiple cells. Low levels in G2/M cells increase with progression through G1 phase and entry and progression through S phase.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000103034 Expressed in 184 organ(s), highest expression level in anterior cingulate cortex

CleanEx database of gene expression profiles

More...
CleanExi
HS_NDRG4

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9ULP0 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9ULP0 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA015313
HPA017587

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
122372, 10 interactors

Protein interaction database and analysis system

More...
IntActi
Q9ULP0, 35 interactors

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q9ULP0

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9ULP0

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi253 – 256Poly-Thr4

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the NDRG family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2931 Eukaryota
ENOG410XSPF LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000154074

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000230891

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG052591

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9ULP0

Identification of Orthologs from Complete Genome Data

More...
OMAi
FFNYEDM

Database of Orthologous Groups

More...
OrthoDBi
EOG091G09VW

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9ULP0

TreeFam database of animal gene trees

More...
TreeFami
TF313168

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.40.50.1820, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR029058 AB_hydrolase
IPR004142 NDRG
IPR030695 NDRG4

The PANTHER Classification System

More...
PANTHERi
PTHR11034 PTHR11034, 1 hit
PTHR11034:SF21 PTHR11034:SF21, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF03096 Ndr, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF53474 SSF53474, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (8+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 8 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 8 described isoforms and 31 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9ULP0-1) [UniParc]FASTAAdd to basket
Also known as: NDRG4-BVar

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPECWDGEHD IETPYGLLHV VIRGSPKGNR PAILTYHDVG LNHKLCFNTF
60 70 80 90 100
FNFEDMQEIT KHFVVCHVDA PGQQVGASQF PQGYQFPSME QLAAMLPSVV
110 120 130 140 150
QHFGFKYVIG IGVGAGAYVL AKFALIFPDL VEGLVLVNID PNGKGWIDWA
160 170 180 190 200
ATKLSGLTST LPDTVLSHLF SQEELVNNTE LVQSYRQQIG NVVNQANLQL
210 220 230 240 250
FWNMYNSRRD LDINRPGTVP NAKTLRCPVM LVVGDNAPAE DGVVECNSKL
260 270 280 290 300
DPTTTTFLKM ADSGGLPQVT QPGKLTEAFK YFLQGMGYIA YLKDRRLSGG
310 320 330 340 350
AVPSASMTRL ARSRTASLTS ASSVDGSRPQ ACTHSESSEG LGQVNHTMEV

SC
Length:352
Mass (Da):38,459
Last modified:January 23, 2002 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i4CFAFC7C820013B6
GO
Isoform 2 (identifier: Q9ULP0-2) [UniParc]FASTAAdd to basket
Also known as: NDRG4-B

The sequence of this isoform differs from the canonical sequence as follows:
     289-302: IAYLKDRRLSGGAV → M

Show »
Length:339
Mass (Da):37,089
Checksum:iE5721D653F9CF056
GO
Isoform 3 (identifier: Q9ULP0-3) [UniParc]FASTAAdd to basket
Also known as: NDRG4-H

The sequence of this isoform differs from the canonical sequence as follows:
     1-7: MPECWDG → MAGLQELRFPEEKPLLRGQDATELESSDAFLLAADTDWK
     289-302: IAYLKDRRLSGGAV → M

Show »
Length:371
Mass (Da):40,645
Checksum:iF7E4FA067E0DD752
GO
Isoform 4 (identifier: Q9ULP0-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     291-303: Missing.

Show »
Length:339
Mass (Da):37,045
Checksum:iE56FB113F95D3056
GO
Isoform 5 (identifier: Q9ULP0-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     43-43: H → RKCSPASVSPPLPPISQSD
     289-302: IAYLKDRRLSGGAV → M

Show »
Length:357
Mass (Da):38,900
Checksum:i80425B23A100DEEB
GO
Isoform 6 (identifier: Q9ULP0-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-7: MPECWDG → MKVLGHRLELLTGLLLHDVTMAGLQELRFPEEKPLLRGQDATELESSDAFLLAADTDWK
     289-302: IAYLKDRRLSGGAV → M

Show »
Length:391
Mass (Da):42,886
Checksum:i2072323C9172C2E3
GO
Isoform 7 (identifier: Q9ULP0-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     7-7: G → GVGEGNAGAVKLAGLGDPRWSPGHLLSPGHQ
     289-302: IAYLKDRRLSGGAV → M

Note: No experimental confirmation available.
Show »
Length:369
Mass (Da):40,049
Checksum:i7DD24F9D2E46FDAE
GO
Isoform 8 (identifier: Q9ULP0-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     7-7: G → GRSQERRLPRVSSTVSPLQ
     289-302: IAYLKDRRLSGGAV → M

Note: No experimental confirmation available.
Show »
Length:357
Mass (Da):39,168
Checksum:i2CA4F68CC3298268
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 31 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H3BQ01H3BQ01_HUMAN
Protein NDRG4
NDRG4
83Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B7Z9X4B7Z9X4_HUMAN
cDNA, FLJ78988, highly similar to P...
NDRG4
284Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BQJ4H3BQJ4_HUMAN
Protein NDRG4
NDRG4
327Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BU25H3BU25_HUMAN
Protein NDRG4
NDRG4
128Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BSC3H3BSC3_HUMAN
Protein NDRG4
NDRG4
109Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BM40H3BM40_HUMAN
Protein NDRG4
NDRG4
199Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BQ86H3BQ86_HUMAN
Protein NDRG4
NDRG4
173Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BNE7H3BNE7_HUMAN
Protein NDRG4
NDRG4
191Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BN97H3BN97_HUMAN
Protein NDRG4
NDRG4
156Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BMR6H3BMR6_HUMAN
Protein NDRG4
NDRG4
149Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There are more potential isoformsShow all

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAA86494 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti10D → N in BAG61777 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0034211 – 7MPECWDG → MAGLQELRFPEEKPLLRGQD ATELESSDAFLLAADTDWK in isoform 3. 1 Publication7
Alternative sequenceiVSP_0229561 – 7MPECWDG → MKVLGHRLELLTGLLLHDVT MAGLQELRFPEEKPLLRGQD ATELESSDAFLLAADTDWK in isoform 6. 1 Publication7
Alternative sequenceiVSP_0458307G → GVGEGNAGAVKLAGLGDPRW SPGHLLSPGHQ in isoform 7. 1 Publication1
Alternative sequenceiVSP_0463267G → GRSQERRLPRVSSTVSPLQ in isoform 8. 1 Publication1
Alternative sequenceiVSP_02295743H → RKCSPASVSPPLPPISQSD in isoform 5. 1 Publication1
Alternative sequenceiVSP_003422289 – 302IAYLK…SGGAV → M in isoform 2, isoform 3, isoform 5, isoform 6, isoform 7 and isoform 8. 4 PublicationsAdd BLAST14
Alternative sequenceiVSP_003423291 – 303Missing in isoform 4. 1 PublicationAdd BLAST13

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB044947 Genomic DNA Translation: BAB20071.1
AB044947 Genomic DNA Translation: BAB20072.1
AB044947 Genomic DNA Translation: BAB20073.1
AB044944 mRNA Translation: BAB20068.1
AB044945 mRNA Translation: BAB20069.1
AB044946 mRNA Translation: BAB20070.1
AF308608 mRNA Translation: AAL08806.1
AB021172 mRNA Translation: BAB20288.1
AL136584 mRNA Translation: CAB66519.1
AK055038 mRNA Translation: BAG51454.1
AK126574 mRNA Translation: BAC86600.1
AK131248 mRNA Translation: BAD18428.1
AK296415 mRNA Translation: BAG59078.1
AK299949 mRNA Translation: BAG61777.1
AC009118 Genomic DNA No translation available.
BC011795 mRNA Translation: AAH11795.1
AB033006 mRNA Translation: BAA86494.2 Different initiation.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS10797.1 [Q9ULP0-3]
CCDS45500.1 [Q9ULP0-6]
CCDS55999.1 [Q9ULP0-7]
CCDS58465.1 [Q9ULP0-8]
CCDS58466.1 [Q9ULP0-1]
CCDS58467.1 [Q9ULP0-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001123959.1, NM_001130487.1 [Q9ULP0-6]
NP_001229762.1, NM_001242833.1 [Q9ULP0-7]
NP_001229763.1, NM_001242834.1 [Q9ULP0-8]
NP_001229764.1, NM_001242835.1 [Q9ULP0-1]
NP_001229765.1, NM_001242836.1 [Q9ULP0-2]
NP_065198.1, NM_020465.3 [Q9ULP0-3]
NP_075061.1, NM_022910.3 [Q9ULP0-3]
XP_016879079.1, XM_017023590.1 [Q9ULP0-3]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.322430

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000258187; ENSP00000258187; ENSG00000103034 [Q9ULP0-3]
ENST00000356752; ENSP00000349193; ENSG00000103034 [Q9ULP0-7]
ENST00000394279; ENSP00000377820; ENSG00000103034 [Q9ULP0-3]
ENST00000394282; ENSP00000377823; ENSG00000103034 [Q9ULP0-6]
ENST00000563799; ENSP00000458113; ENSG00000103034 [Q9ULP0-5]
ENST00000566192; ENSP00000454410; ENSG00000103034 [Q9ULP0-2]
ENST00000568640; ENSP00000456338; ENSG00000103034 [Q9ULP0-8]
ENST00000570248; ENSP00000457659; ENSG00000103034 [Q9ULP0-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
65009

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:65009

UCSC genome browser

More...
UCSCi
uc002enk.4 human [Q9ULP0-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB044947 Genomic DNA Translation: BAB20071.1
AB044947 Genomic DNA Translation: BAB20072.1
AB044947 Genomic DNA Translation: BAB20073.1
AB044944 mRNA Translation: BAB20068.1
AB044945 mRNA Translation: BAB20069.1
AB044946 mRNA Translation: BAB20070.1
AF308608 mRNA Translation: AAL08806.1
AB021172 mRNA Translation: BAB20288.1
AL136584 mRNA Translation: CAB66519.1
AK055038 mRNA Translation: BAG51454.1
AK126574 mRNA Translation: BAC86600.1
AK131248 mRNA Translation: BAD18428.1
AK296415 mRNA Translation: BAG59078.1
AK299949 mRNA Translation: BAG61777.1
AC009118 Genomic DNA No translation available.
BC011795 mRNA Translation: AAH11795.1
AB033006 mRNA Translation: BAA86494.2 Different initiation.
CCDSiCCDS10797.1 [Q9ULP0-3]
CCDS45500.1 [Q9ULP0-6]
CCDS55999.1 [Q9ULP0-7]
CCDS58465.1 [Q9ULP0-8]
CCDS58466.1 [Q9ULP0-1]
CCDS58467.1 [Q9ULP0-2]
RefSeqiNP_001123959.1, NM_001130487.1 [Q9ULP0-6]
NP_001229762.1, NM_001242833.1 [Q9ULP0-7]
NP_001229763.1, NM_001242834.1 [Q9ULP0-8]
NP_001229764.1, NM_001242835.1 [Q9ULP0-1]
NP_001229765.1, NM_001242836.1 [Q9ULP0-2]
NP_065198.1, NM_020465.3 [Q9ULP0-3]
NP_075061.1, NM_022910.3 [Q9ULP0-3]
XP_016879079.1, XM_017023590.1 [Q9ULP0-3]
UniGeneiHs.322430

3D structure databases

ProteinModelPortaliQ9ULP0
SMRiQ9ULP0
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi122372, 10 interactors
IntActiQ9ULP0, 35 interactors

Protein family/group databases

ESTHERihuman-NDRG4 Ndr_family
MEROPSiS33.986

PTM databases

iPTMnetiQ9ULP0
PhosphoSitePlusiQ9ULP0

Polymorphism and mutation databases

BioMutaiNDRG4
DMDMi20141614

Proteomic databases

EPDiQ9ULP0
PaxDbiQ9ULP0
PeptideAtlasiQ9ULP0
PRIDEiQ9ULP0
ProteomicsDBi85084
85085 [Q9ULP0-2]
85086 [Q9ULP0-3]
85087 [Q9ULP0-4]
85088 [Q9ULP0-5]
85089 [Q9ULP0-6]
TopDownProteomicsiQ9ULP0-3 [Q9ULP0-3]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
65009
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000258187; ENSP00000258187; ENSG00000103034 [Q9ULP0-3]
ENST00000356752; ENSP00000349193; ENSG00000103034 [Q9ULP0-7]
ENST00000394279; ENSP00000377820; ENSG00000103034 [Q9ULP0-3]
ENST00000394282; ENSP00000377823; ENSG00000103034 [Q9ULP0-6]
ENST00000563799; ENSP00000458113; ENSG00000103034 [Q9ULP0-5]
ENST00000566192; ENSP00000454410; ENSG00000103034 [Q9ULP0-2]
ENST00000568640; ENSP00000456338; ENSG00000103034 [Q9ULP0-8]
ENST00000570248; ENSP00000457659; ENSG00000103034 [Q9ULP0-1]
GeneIDi65009
KEGGihsa:65009
UCSCiuc002enk.4 human [Q9ULP0-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
65009
DisGeNETi65009
EuPathDBiHostDB:ENSG00000103034.14

GeneCards: human genes, protein and diseases

More...
GeneCardsi
NDRG4
HGNCiHGNC:14466 NDRG4
HPAiHPA015313
HPA017587
MIMi614463 gene
neXtProtiNX_Q9ULP0
OpenTargetsiENSG00000103034
PharmGKBiPA31485

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG2931 Eukaryota
ENOG410XSPF LUCA
GeneTreeiENSGT00940000154074
HOGENOMiHOG000230891
HOVERGENiHBG052591
InParanoidiQ9ULP0
OMAiFFNYEDM
OrthoDBiEOG091G09VW
PhylomeDBiQ9ULP0
TreeFamiTF313168

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
NDRG4 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
NDRG4

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
65009

Protein Ontology

More...
PROi
PR:Q9ULP0

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000103034 Expressed in 184 organ(s), highest expression level in anterior cingulate cortex
CleanExiHS_NDRG4
ExpressionAtlasiQ9ULP0 baseline and differential
GenevisibleiQ9ULP0 HS

Family and domain databases

Gene3Di3.40.50.1820, 1 hit
InterProiView protein in InterPro
IPR029058 AB_hydrolase
IPR004142 NDRG
IPR030695 NDRG4
PANTHERiPTHR11034 PTHR11034, 1 hit
PTHR11034:SF21 PTHR11034:SF21, 1 hit
PfamiView protein in Pfam
PF03096 Ndr, 1 hit
SUPFAMiSSF53474 SSF53474, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiNDRG4_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9ULP0
Secondary accession number(s): B3KNU2
, B4DK66, B4DSW5, H7C600, Q6ZNE7, Q6ZTI7, Q96PL9, Q9GZM1, Q9GZN3, Q9GZX0
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: January 23, 2002
Last modified: December 5, 2018
This is version 152 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again