Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein NDRG4

Gene

NDRG4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Contributes to the maintenance of intracerebral BDNF levels within the normal range, which is necessary for the preservation of spatial learning and the resistance to neuronal cell death caused by ischemic stress (By similarity). May enhance growth factor-induced ERK1 and ERK2 phosphorylation, including that induced by PDGF and FGF. May attenuate NGF-promoted ELK1 phosphorylation in a microtubule-dependent manner.By similarity1 Publication

GO - Biological processi

Protein family/group databases

ESTHERihuman-NDRG4 Ndr_family
MEROPSiS33.986

Names & Taxonomyi

Protein namesi
Recommended name:
Protein NDRG4
Alternative name(s):
Brain development-related molecule 1
N-myc downstream-regulated gene 4 protein
Vascular smooth muscle cell-associated protein 8
Short name:
SMAP-8
Gene namesi
Name:NDRG4
Synonyms:BDM1, KIAA1180
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 16

Organism-specific databases

EuPathDBiHostDB:ENSG00000103034.14
HGNCiHGNC:14466 NDRG4
MIMi614463 gene
neXtProtiNX_Q9ULP0

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

DisGeNETi65009
OpenTargetsiENSG00000103034
PharmGKBiPA31485

Polymorphism and mutation databases

BioMutaiNDRG4
DMDMi20141614

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001595791 – 352Protein NDRG4Add BLAST352

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei298PhosphoserineBy similarity1
Modified residuei317PhosphoserineBy similarity1
Modified residuei323PhosphoserineBy similarity1

Post-translational modificationi

Phosphorylated in an aortic smooth muscle cell line, following PDGF treatment.1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ9ULP0
PaxDbiQ9ULP0
PeptideAtlasiQ9ULP0
PRIDEiQ9ULP0
ProteomicsDBi85084
85085 [Q9ULP0-2]
85086 [Q9ULP0-3]
85087 [Q9ULP0-4]
85088 [Q9ULP0-5]
85089 [Q9ULP0-6]
TopDownProteomicsiQ9ULP0-3 [Q9ULP0-3]

PTM databases

iPTMnetiQ9ULP0
PhosphoSitePlusiQ9ULP0

Expressioni

Tissue specificityi

Expressed predominantly in brain and heart (at protein level). In the brain, detected in astrocytes. Isoform 1 and isoform 2 are only expressed in brain. Isoform 3 is expressed in both heart and brain. Up-regulated in glioblastoma multiforme cells.3 Publications

Developmental stagei

Expressed in a cell cycle-specific manner in glioblastoma multiple cells. Low levels in G2/M cells increase with progression through G1 phase and entry and progression through S phase.1 Publication

Gene expression databases

BgeeiENSG00000103034
CleanExiHS_NDRG4
ExpressionAtlasiQ9ULP0 baseline and differential
GenevisibleiQ9ULP0 HS

Organism-specific databases

HPAiHPA015313
HPA017587

Interactioni

Binary interactionsi

Show more details

Protein-protein interaction databases

BioGridi122372, 9 interactors
IntActiQ9ULP0, 17 interactors

Structurei

3D structure databases

ProteinModelPortaliQ9ULP0
SMRiQ9ULP0
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi253 – 256Poly-Thr4

Sequence similaritiesi

Belongs to the NDRG family.Curated

Phylogenomic databases

eggNOGiKOG2931 Eukaryota
ENOG410XSPF LUCA
GeneTreeiENSGT00390000001874
HOGENOMiHOG000230891
HOVERGENiHBG052591
InParanoidiQ9ULP0
OMAiFFNYEDM
OrthoDBiEOG091G09VW
PhylomeDBiQ9ULP0
TreeFamiTF313168

Family and domain databases

Gene3Di3.40.50.1820, 1 hit
InterProiView protein in InterPro
IPR029058 AB_hydrolase
IPR004142 NDRG
IPR030695 NDRG4
PANTHERiPTHR11034 PTHR11034, 1 hit
PTHR11034:SF21 PTHR11034:SF21, 1 hit
PfamiView protein in Pfam
PF03096 Ndr, 1 hit
SUPFAMiSSF53474 SSF53474, 1 hit

Sequences (8)i

Sequence statusi: Complete.

This entry describes 8 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9ULP0-1) [UniParc]FASTAAdd to basket
Also known as: NDRG4-BVar

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPECWDGEHD IETPYGLLHV VIRGSPKGNR PAILTYHDVG LNHKLCFNTF
60 70 80 90 100
FNFEDMQEIT KHFVVCHVDA PGQQVGASQF PQGYQFPSME QLAAMLPSVV
110 120 130 140 150
QHFGFKYVIG IGVGAGAYVL AKFALIFPDL VEGLVLVNID PNGKGWIDWA
160 170 180 190 200
ATKLSGLTST LPDTVLSHLF SQEELVNNTE LVQSYRQQIG NVVNQANLQL
210 220 230 240 250
FWNMYNSRRD LDINRPGTVP NAKTLRCPVM LVVGDNAPAE DGVVECNSKL
260 270 280 290 300
DPTTTTFLKM ADSGGLPQVT QPGKLTEAFK YFLQGMGYIA YLKDRRLSGG
310 320 330 340 350
AVPSASMTRL ARSRTASLTS ASSVDGSRPQ ACTHSESSEG LGQVNHTMEV

SC
Length:352
Mass (Da):38,459
Last modified:January 23, 2002 - v2
Checksum:i4CFAFC7C820013B6
GO
Isoform 2 (identifier: Q9ULP0-2) [UniParc]FASTAAdd to basket
Also known as: NDRG4-B

The sequence of this isoform differs from the canonical sequence as follows:
     289-302: IAYLKDRRLSGGAV → M

Show »
Length:339
Mass (Da):37,089
Checksum:iE5721D653F9CF056
GO
Isoform 3 (identifier: Q9ULP0-3) [UniParc]FASTAAdd to basket
Also known as: NDRG4-H

The sequence of this isoform differs from the canonical sequence as follows:
     1-7: MPECWDG → MAGLQELRFPEEKPLLRGQDATELESSDAFLLAADTDWK
     289-302: IAYLKDRRLSGGAV → M

Show »
Length:371
Mass (Da):40,645
Checksum:iF7E4FA067E0DD752
GO
Isoform 4 (identifier: Q9ULP0-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     291-303: Missing.

Show »
Length:339
Mass (Da):37,045
Checksum:iE56FB113F95D3056
GO
Isoform 5 (identifier: Q9ULP0-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     43-43: H → RKCSPASVSPPLPPISQSD
     289-302: IAYLKDRRLSGGAV → M

Show »
Length:357
Mass (Da):38,900
Checksum:i80425B23A100DEEB
GO
Isoform 6 (identifier: Q9ULP0-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-7: MPECWDG → MKVLGHRLELLTGLLLHDVTMAGLQELRFPEEKPLLRGQDATELESSDAFLLAADTDWK
     289-302: IAYLKDRRLSGGAV → M

Show »
Length:391
Mass (Da):42,886
Checksum:i2072323C9172C2E3
GO
Isoform 7 (identifier: Q9ULP0-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     7-7: G → GVGEGNAGAVKLAGLGDPRWSPGHLLSPGHQ
     289-302: IAYLKDRRLSGGAV → M

Note: No experimental confirmation available.
Show »
Length:369
Mass (Da):40,049
Checksum:i7DD24F9D2E46FDAE
GO
Isoform 8 (identifier: Q9ULP0-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     7-7: G → GRSQERRLPRVSSTVSPLQ
     289-302: IAYLKDRRLSGGAV → M

Note: No experimental confirmation available.
Show »
Length:357
Mass (Da):39,168
Checksum:i2CA4F68CC3298268
GO

Sequence cautioni

The sequence BAA86494 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti10D → N in BAG61777 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0034211 – 7MPECWDG → MAGLQELRFPEEKPLLRGQD ATELESSDAFLLAADTDWK in isoform 3. 1 Publication7
Alternative sequenceiVSP_0229561 – 7MPECWDG → MKVLGHRLELLTGLLLHDVT MAGLQELRFPEEKPLLRGQD ATELESSDAFLLAADTDWK in isoform 6. 1 Publication7
Alternative sequenceiVSP_0458307G → GVGEGNAGAVKLAGLGDPRW SPGHLLSPGHQ in isoform 7. 1 Publication1
Alternative sequenceiVSP_0463267G → GRSQERRLPRVSSTVSPLQ in isoform 8. 1 Publication1
Alternative sequenceiVSP_02295743H → RKCSPASVSPPLPPISQSD in isoform 5. 1 Publication1
Alternative sequenceiVSP_003422289 – 302IAYLK…SGGAV → M in isoform 2, isoform 3, isoform 5, isoform 6, isoform 7 and isoform 8. 4 PublicationsAdd BLAST14
Alternative sequenceiVSP_003423291 – 303Missing in isoform 4. 1 PublicationAdd BLAST13

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB044947 Genomic DNA Translation: BAB20071.1
AB044947 Genomic DNA Translation: BAB20072.1
AB044947 Genomic DNA Translation: BAB20073.1
AB044944 mRNA Translation: BAB20068.1
AB044945 mRNA Translation: BAB20069.1
AB044946 mRNA Translation: BAB20070.1
AF308608 mRNA Translation: AAL08806.1
AB021172 mRNA Translation: BAB20288.1
AL136584 mRNA Translation: CAB66519.1
AK055038 mRNA Translation: BAG51454.1
AK126574 mRNA Translation: BAC86600.1
AK131248 mRNA Translation: BAD18428.1
AK296415 mRNA Translation: BAG59078.1
AK299949 mRNA Translation: BAG61777.1
AC009118 Genomic DNA No translation available.
BC011795 mRNA Translation: AAH11795.1
AB033006 mRNA Translation: BAA86494.2 Different initiation.
CCDSiCCDS10797.1 [Q9ULP0-3]
CCDS45500.1 [Q9ULP0-6]
CCDS55999.1 [Q9ULP0-7]
CCDS58465.1 [Q9ULP0-8]
CCDS58466.1 [Q9ULP0-1]
CCDS58467.1 [Q9ULP0-2]
RefSeqiNP_001123959.1, NM_001130487.1 [Q9ULP0-6]
NP_001229762.1, NM_001242833.1 [Q9ULP0-7]
NP_001229763.1, NM_001242834.1 [Q9ULP0-8]
NP_001229764.1, NM_001242835.1 [Q9ULP0-1]
NP_001229765.1, NM_001242836.1 [Q9ULP0-2]
NP_065198.1, NM_020465.3 [Q9ULP0-3]
NP_075061.1, NM_022910.3 [Q9ULP0-3]
XP_016879079.1, XM_017023590.1 [Q9ULP0-3]
UniGeneiHs.322430

Genome annotation databases

EnsembliENST00000258187; ENSP00000258187; ENSG00000103034 [Q9ULP0-3]
ENST00000356752; ENSP00000349193; ENSG00000103034 [Q9ULP0-7]
ENST00000394279; ENSP00000377820; ENSG00000103034 [Q9ULP0-3]
ENST00000394282; ENSP00000377823; ENSG00000103034 [Q9ULP0-6]
ENST00000563799; ENSP00000458113; ENSG00000103034 [Q9ULP0-5]
ENST00000566192; ENSP00000454410; ENSG00000103034 [Q9ULP0-2]
ENST00000568640; ENSP00000456338; ENSG00000103034 [Q9ULP0-8]
ENST00000570248; ENSP00000457659; ENSG00000103034 [Q9ULP0-1]
GeneIDi65009
KEGGihsa:65009
UCSCiuc002enk.4 human [Q9ULP0-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiNDRG4_HUMAN
AccessioniPrimary (citable) accession number: Q9ULP0
Secondary accession number(s): B3KNU2
, B4DK66, B4DSW5, H7C600, Q6ZNE7, Q6ZTI7, Q96PL9, Q9GZM1, Q9GZN3, Q9GZX0
Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: January 23, 2002
Last modified: June 20, 2018
This is version 147 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health