Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 145 (12 Aug 2020)
Sequence version 2 (13 Nov 2007)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Pleckstrin homology domain-containing family H member 1

Gene

PLEKHH1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q9ULM0

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Pleckstrin homology domain-containing family H member 1
Short name:
PH domain-containing family H member 1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:PLEKHH1
Synonyms:KIAA1200
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 14

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000054690.13

Human Gene Nomenclature Database

More...
HGNCi
HGNC:17733, PLEKHH1

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9ULM0

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
57475

Open Targets

More...
OpenTargetsi
ENSG00000054690

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134879998

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q9ULM0, Tdark

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
PLEKHH1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
160418959

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003109481 – 1364Pleckstrin homology domain-containing family H member 1Add BLAST1364

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei745PhosphoserineBy similarity1

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9ULM0

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9ULM0

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q9ULM0

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9ULM0

PeptideAtlas

More...
PeptideAtlasi
Q9ULM0

PRoteomics IDEntifications database

More...
PRIDEi
Q9ULM0

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
85075 [Q9ULM0-1]
85076 [Q9ULM0-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9ULM0

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9ULM0

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000054690, Expressed in left lobe of thyroid gland and 200 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9ULM0, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9ULM0, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000054690, Tissue enhanced (brain, thyroid gland)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
121545, 3 interactors

Protein interaction database and analysis system

More...
IntActi
Q9ULM0, 4 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000330278

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q9ULM0, protein

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini578 – 672PH 1PROSITE-ProRule annotationAdd BLAST95
Domaini687 – 796PH 2PROSITE-ProRule annotationAdd BLAST110
Domaini832 – 986MyTH4PROSITE-ProRule annotationAdd BLAST155
Domaini997 – 1333FERMPROSITE-ProRule annotationAdd BLAST337

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and domains' section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili28 – 169Sequence analysisAdd BLAST142

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi239 – 242Poly-Ser4

Keywords - Domaini

Coiled coil, Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0248, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000159456

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_001626_3_1_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9ULM0

KEGG Orthology (KO)

More...
KOi
K24020

Identification of Orthologs from Complete Genome Data

More...
OMAi
PAYSFVQ

Database of Orthologous Groups

More...
OrthoDBi
75793at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9ULM0

TreeFam database of animal gene trees

More...
TreeFami
TF312866

Family and domain databases

Conserved Domains Database

More...
CDDi
cd14473, FERM_B-lobe, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.20.80.10, 1 hit
1.25.40.530, 1 hit
2.30.29.30, 3 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR019749, Band_41_domain
IPR014352, FERM/acyl-CoA-bd_prot_sf
IPR035963, FERM_2
IPR019748, FERM_central
IPR000299, FERM_domain
IPR000857, MyTH4_dom
IPR038185, MyTH4_dom_sf
IPR011993, PH-like_dom_sf
IPR001849, PH_domain
IPR040105, PKHH1

The PANTHER Classification System

More...
PANTHERi
PTHR22903:SF4, PTHR22903:SF4, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00373, FERM_M, 1 hit
PF00784, MyTH4, 1 hit
PF00169, PH, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00295, B41, 1 hit
SM00139, MyTH4, 1 hit
SM00233, PH, 2 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF47031, SSF47031, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50057, FERM_3, 1 hit
PS51016, MYTH4, 1 hit
PS50003, PH_DOMAIN, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9ULM0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAELKVEAPA SVDWQKRCLT LETQLFRFRL QASKIRELLA DKMQELEQRL
60 70 80 90 100
LEAEQRAENA ETQVGVMEEK VKLSNLKNVD SEGSLHRKYQ ELLKAIKGKD
110 120 130 140 150
ELISQLEAQL EKQKQMRAEE AKTVQEKAAK IKEWVTLKLA KLEMENQHLK
160 170 180 190 200
SHNQRLVEQV GSLQDALEAI QIAPSRKLLV PPYGAAEQDS VPSEPGIQPM
210 220 230 240 250
GQDSGSQAQG LKAAVLAPSP GALQSKDSVS EAASPLEDSS SSTVHSGETV
260 270 280 290 300
EAKPLQPHLG RESPPHQPCM KLLTFRCSSA SWGEGLVTAQ RGMLPGTKTS
310 320 330 340 350
AREGGPGSSL TLPKVRAPGT PRDSIQLAKR HHSQPQVGHG HFGRVVNIET
360 370 380 390 400
EAFSALHPSG LPELESRARS REEPEKMEME EPPPAGKNEE RESPKALGAE
410 420 430 440 450
LEEVELGNKP PTPPLHQFSS WESRIYAVAT SGMRLSDMSP RSNTACCASS
460 470 480 490 500
PPALVSPGSF SGLVYKNVTV PVYTALKGRA TQISNMPFMD ESSGSDDDCS
510 520 530 540 550
SQASFRISVP SSESRKTSGL GSPRAIKRGV SMSSLSSEGD YAIPPDACSL
560 570 580 590 600
DSDYSEPEHK LQRTSSYSTD GLGLGGESLE KSGYLLKMGS QVKTWKRRWF
610 620 630 640 650
VLRQGQIMYY KSPSDVIRKP QGQVDLNSRC QIVRGEGSQT FQLISEKKTY
660 670 680 690 700
YLTADSPSLL EEWIRVLQSL LKVQATGPPA LLRGGTKPTV KGWLTKVKHG
710 720 730 740 750
HSKVVWCALV GKIFYYYRSH EDKRPLGCLP VRDAHIEEVD RSCDSDEDYE
760 770 780 790 800
AGGTRRLLSS HCTLVIHPTE HSPTYLLIGT KHEKDTWLYH LTVAAGGSSA
810 820 830 840 850
KVGTAYEQLI GKLMDGEGDP DSPLWRHPML CYSKDGLYAS LTTLPSEALQ
860 870 880 890 900
TEALKLFKSC QLFINVPVEA ASVDYHVSLA QTALQVCLVH PELQSEIYCQ
910 920 930 940 950
LMKQTSCRPP QKYSLMQCWQ LLALCAPLFL PQHHFLWYVK QQLQRHADPR
960 970 980 990 1000
SETGQYATYC QRAVERTLRT GEREARPSRM EVVSILLRNP FHHSLPFSIP
1010 1020 1030 1040 1050
VHFTNGTYHV VGFDGSSTVD EFLQRLNQEI GMRKPSHSGF ALFTDDPSGR
1060 1070 1080 1090 1100
DLEHCLQGSV KICDAISKWE QAMKELHPGK SEGGTRVVKL MYKNRLYFRS
1110 1120 1130 1140 1150
QVKGETDRER LLLASQTSRE IVAGRFPINK ELALEMAALM AQVEYGDLEK
1160 1170 1180 1190 1200
PALPGPGGTS PAKAQHLLQQ VLDRFHPRRY RHGAPAEQLR HLADMLTTKW
1210 1220 1230 1240 1250
ATLQGCSPPE CIRIYLTVAR KWPFFGAKLF AAQPAQLSSK ENALVWIAVN
1260 1270 1280 1290 1300
EDGVSILDHN TMQVHITYPY SSVTTFGGCR DDFMLVIRSI PDKSSGKSHI
1310 1320 1330 1340 1350
EKLIFRMAAP KIAEATFIMA SYMNHCTTTV NPPTNPPGAC QLWELDGRQF
1360
FSSVSCATKG PTLL
Length:1,364
Mass (Da):151,232
Last modified:November 13, 2007 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i695F4B1A05566F6C
GO
Isoform 2 (identifier: Q9ULM0-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-485: Missing.
     724-754: RPLGCLPVRDAHIEEVDRSCDSDEDYEAGGT → VLLSLLTIPTLLLPPKHMTATLCPDESPYPT
     755-1364: Missing.

Show »
Length:269
Mass (Da):29,849
Checksum:iFEB6C418EA5ADA6D
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0YKY5H0YKY5_HUMAN
Pleckstrin homology domain-containi...
PLEKHH1
182Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YMQ6H0YMQ6_HUMAN
Pleckstrin homology domain-containi...
PLEKHH1
81Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YLU5H0YLU5_HUMAN
Pleckstrin homology domain-containi...
PLEKHH1
34Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAA86514 differs from that shown. Reason: Erroneous initiation.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_03709475N → S. Corresponds to variant dbSNP:rs7150973Ensembl.1
Natural variantiVAR_037095113Q → L. Corresponds to variant dbSNP:rs3825723Ensembl.1
Natural variantiVAR_037096322R → Q. Corresponds to variant dbSNP:rs2236235Ensembl.1
Natural variantiVAR_037097430T → A. Corresponds to variant dbSNP:rs3825725Ensembl.1
Natural variantiVAR_037098438M → V. Corresponds to variant dbSNP:rs17104428Ensembl.1
Natural variantiVAR_037099735H → R. Corresponds to variant dbSNP:rs11158685Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0293471 – 485Missing in isoform 2. 1 PublicationAdd BLAST485
Alternative sequenceiVSP_029348724 – 754RPLGC…EAGGT → VLLSLLTIPTLLLPPKHMTA TLCPDESPYPT in isoform 2. 1 PublicationAdd BLAST31
Alternative sequenceiVSP_029349755 – 1364Missing in isoform 2. 1 PublicationAdd BLAST610

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB033026 mRNA Translation: BAA86514.1 Different initiation.
AK123305 mRNA No translation available.
BC014159 mRNA Translation: AAH14159.1
BC146787 mRNA Translation: AAI46788.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS45128.1 [Q9ULM0-1]

NCBI Reference Sequences

More...
RefSeqi
NP_065766.1, NM_020715.2 [Q9ULM0-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000329153; ENSP00000330278; ENSG00000054690 [Q9ULM0-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
57475

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:57475

UCSC genome browser

More...
UCSCi
uc001xjl.2, human [Q9ULM0-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB033026 mRNA Translation: BAA86514.1 Different initiation.
AK123305 mRNA No translation available.
BC014159 mRNA Translation: AAH14159.1
BC146787 mRNA Translation: AAI46788.1
CCDSiCCDS45128.1 [Q9ULM0-1]
RefSeqiNP_065766.1, NM_020715.2 [Q9ULM0-1]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGRIDi121545, 3 interactors
IntActiQ9ULM0, 4 interactors
STRINGi9606.ENSP00000330278

PTM databases

iPTMnetiQ9ULM0
PhosphoSitePlusiQ9ULM0

Polymorphism and mutation databases

BioMutaiPLEKHH1
DMDMi160418959

Proteomic databases

EPDiQ9ULM0
jPOSTiQ9ULM0
MassIVEiQ9ULM0
PaxDbiQ9ULM0
PeptideAtlasiQ9ULM0
PRIDEiQ9ULM0
ProteomicsDBi85075 [Q9ULM0-1]
85076 [Q9ULM0-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
64198, 71 antibodies

Genome annotation databases

EnsembliENST00000329153; ENSP00000330278; ENSG00000054690 [Q9ULM0-1]
GeneIDi57475
KEGGihsa:57475
UCSCiuc001xjl.2, human [Q9ULM0-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
57475
DisGeNETi57475
EuPathDBiHostDB:ENSG00000054690.13

GeneCards: human genes, protein and diseases

More...
GeneCardsi
PLEKHH1
HGNCiHGNC:17733, PLEKHH1
HPAiENSG00000054690, Tissue enhanced (brain, thyroid gland)
neXtProtiNX_Q9ULM0
OpenTargetsiENSG00000054690
PharmGKBiPA134879998

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0248, Eukaryota
GeneTreeiENSGT00940000159456
HOGENOMiCLU_001626_3_1_1
InParanoidiQ9ULM0
KOiK24020
OMAiPAYSFVQ
OrthoDBi75793at2759
PhylomeDBiQ9ULM0
TreeFamiTF312866

Enzyme and pathway databases

PathwayCommonsiQ9ULM0

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
57475, 11 hits in 876 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
PLEKHH1, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
57475
PharosiQ9ULM0, Tdark

Protein Ontology

More...
PROi
PR:Q9ULM0
RNActiQ9ULM0, protein

Gene expression databases

BgeeiENSG00000054690, Expressed in left lobe of thyroid gland and 200 other tissues
ExpressionAtlasiQ9ULM0, baseline and differential
GenevisibleiQ9ULM0, HS

Family and domain databases

CDDicd14473, FERM_B-lobe, 1 hit
Gene3Di1.20.80.10, 1 hit
1.25.40.530, 1 hit
2.30.29.30, 3 hits
InterProiView protein in InterPro
IPR019749, Band_41_domain
IPR014352, FERM/acyl-CoA-bd_prot_sf
IPR035963, FERM_2
IPR019748, FERM_central
IPR000299, FERM_domain
IPR000857, MyTH4_dom
IPR038185, MyTH4_dom_sf
IPR011993, PH-like_dom_sf
IPR001849, PH_domain
IPR040105, PKHH1
PANTHERiPTHR22903:SF4, PTHR22903:SF4, 1 hit
PfamiView protein in Pfam
PF00373, FERM_M, 1 hit
PF00784, MyTH4, 1 hit
PF00169, PH, 1 hit
SMARTiView protein in SMART
SM00295, B41, 1 hit
SM00139, MyTH4, 1 hit
SM00233, PH, 2 hits
SUPFAMiSSF47031, SSF47031, 1 hit
PROSITEiView protein in PROSITE
PS50057, FERM_3, 1 hit
PS51016, MYTH4, 1 hit
PS50003, PH_DOMAIN, 2 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPKHH1_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9ULM0
Secondary accession number(s): A6H8X6, Q6PJL4, Q6ZWC7
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 13, 2007
Last sequence update: November 13, 2007
Last modified: August 12, 2020
This is version 145 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 14
    Human chromosome 14: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again