Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 155 (08 May 2019)
Sequence version 2 (31 Aug 2004)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Plexin-B3

Gene

PLXNB3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Receptor for SEMA5A that plays a role in axon guidance, invasive growth and cell migration. Stimulates neurite outgrowth and mediates Ca2+/Mg2+-dependent cell aggregation. In glioma cells, SEMA5A stimulation of PLXNB3 results in the disassembly of F-actin stress fibers, disruption of focal adhesions and cellular collapse as well as inhibition of cell migration and invasion through ARHGDIA-mediated inactivation of RAC1.3 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionReceptor
Biological processNeurogenesis

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-416700 Other semaphorin interactions

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
Q9ULL4

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Plexin-B3
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:PLXNB3
Synonyms:KIAA1206, PLXN6
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome X

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:9105 PLXNB3

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
300214 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9ULL4

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini45 – 1255ExtracellularSequence analysisAdd BLAST1211
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei1256 – 1276HelicalSequence analysisAdd BLAST21
Topological domaini1277 – 1909CytoplasmicSequence analysisAdd BLAST633

Keywords - Cellular componenti

Cell membrane, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
5365

Open Targets

More...
OpenTargetsi
ENSG00000198753

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA33431

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
PLXNB3

Domain mapping of disease mutations (DMDM)

More...
DMDMi
51701857

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 44Sequence analysisAdd BLAST44
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000002467445 – 1909Plexin-B3Add BLAST1865

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi51N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi98 ↔ 107PROSITE-ProRule annotation
Disulfide bondi132 ↔ 140PROSITE-ProRule annotation
Glycosylationi231N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi267 ↔ 370PROSITE-ProRule annotation
Disulfide bondi283 ↔ 315PROSITE-ProRule annotation
Disulfide bondi333 ↔ 357PROSITE-ProRule annotation
Disulfide bondi474 ↔ 491PROSITE-ProRule annotation
Disulfide bondi480 ↔ 525PROSITE-ProRule annotation
Disulfide bondi483 ↔ 500PROSITE-ProRule annotation
Disulfide bondi494 ↔ 506PROSITE-ProRule annotation
Disulfide bondi562 ↔ 580PROSITE-ProRule annotation
Glycosylationi615N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi802N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi900N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi957N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi1101N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi1218N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9ULL4

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9ULL4

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9ULL4

PeptideAtlas

More...
PeptideAtlasi
Q9ULL4

PRoteomics IDEntifications database

More...
PRIDEi
Q9ULL4

ProteomicsDB human proteome resource

More...
ProteomicsDBi
85069

PTM databases

GlyConnect protein glycosylation platform

More...
GlyConnecti
1614

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9ULL4

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9ULL4

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expression detected in Purkinje and granular cells in cerebellum, and in brain neocortex but not in corpus callosum. Expressed in glioma cells and embryonic kidney cells (at protein level). Expressed in brain, liver, pancreas and placenta, with weak expression detected also in lung and kidney. Expressed in several glioma cell lines.3 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000198753 Expressed in 89 organ(s), highest expression level in substantia nigra

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9ULL4 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9ULL4 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA048046

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts (via cytoplasmic domain) with RAC1 and ARHGDIA (By similarity). Binds MET and MST1R. Interacts (via cytoplasmic domain) with FSCN1. Interacts with RIT2/RIN. May form homodimers (via Sema domain).By similarity3 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
111378, 7 interactors

Protein interaction database and analysis system

More...
IntActi
Q9ULL4, 11 interactors

Molecular INTeraction database

More...
MINTi
Q9ULL4

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000442736

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9ULL4

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini45 – 471SemaPROSITE-ProRule annotationAdd BLAST427
Domaini473 – 526PSI 1Add BLAST54
Domaini620 – 682PSI 2Add BLAST63
Domaini787 – 833PSI 3Add BLAST47
Domaini835 – 925IPT/TIG 1Add BLAST91
Domaini927 – 1012IPT/TIG 2Add BLAST86
Domaini1015 – 1145IPT/TIG 3Add BLAST131
Domaini1159 – 1244IPT/TIG 4Add BLAST86

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the plexin family.Curated

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3610 Eukaryota
ENOG410XR88 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00950000182830

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000231376

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9ULL4

KEGG Orthology (KO)

More...
KOi
K06821

Identification of Orthologs from Complete Genome Data

More...
OMAi
HGQHLQT

Database of Orthologous Groups

More...
OrthoDBi
90434at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9ULL4

TreeFam database of animal gene trees

More...
TreeFami
TF312962

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.130.10.10, 1 hit
2.60.40.10, 4 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR013783 Ig-like_fold
IPR014756 Ig_E-set
IPR002909 IPT_dom
IPR031148 Plexin
IPR013548 Plexin_cytoplasmic_RasGAP_dom
IPR002165 Plexin_repeat
IPR016201 PSI
IPR008936 Rho_GTPase_activation_prot
IPR001627 Semap_dom
IPR036352 Semap_dom_sf
IPR041019 TIG1_plexin
IPR041362 TIG2_plexin
IPR015943 WD40/YVTN_repeat-like_dom_sf

The PANTHER Classification System

More...
PANTHERi
PTHR22625 PTHR22625, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF08337 Plexin_cytopl, 1 hit
PF01437 PSI, 1 hit
PF01403 Sema, 1 hit
PF01833 TIG, 3 hits
PF18020 TIG_2, 1 hit
PF17960 TIG_plexin, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00429 IPT, 3 hits
SM00423 PSI, 3 hits
SM00630 Sema, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF101912 SSF101912, 1 hit
SSF48350 SSF48350, 1 hit
SSF81296 SSF81296, 4 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51004 SEMA, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9ULL4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MCHAAQETPL LHHFMAPVMA RWPPFGLCLL LLLLSPPPLP LTGAHRFSAP
60 70 80 90 100
NTTLNHLALA PGRGTLYVGA VNRLFQLSPE LQLEAVAVTG PVIDSPDCVP
110 120 130 140 150
FRDPAECPQA QLTDNANQLL LVSSRAQELV ACGQVRQGVC ETRRLGDVAE
160 170 180 190 200
VLYQAEDPGD GQFVAANTPG VATVGLVVPL PGRDLLLVAR GLAGKLSAGV
210 220 230 240 250
PPLAIRQLAG SQPFSSEGLG RLVVGDFSDY NNSYVGAFAD ARSAYFVFRR
260 270 280 290 300
RGARAQAEYR SYVARVCLGD TNLYSYVEVP LACQGQGLIQ AAFLAPGTLL
310 320 330 340 350
GVFAAGPRGT QAALCAFPMV ELGASMEQAR RLCYTAGGRG PSGAEEATVE
360 370 380 390 400
YGVTSRCVTL PLDSPESYPC GDEHTPSPIA GRQPLEVQPL LKLGQPVSAV
410 420 430 440 450
AALQADGHMI AFLGDTQGQL YKVFLHGSQG QVYHSQQVGP PGSAISPDLL
460 470 480 490 500
LDSSGSHLYV LTAHQVDRIP VAACPQFPDC ASCLQAQDPL CGWCVLQGRC
510 520 530 540 550
TRKGQCGRAG QLNQWLWSYE EDSHCLHIQS LLPGHHPRQE QGQVTLSVPR
560 570 580 590 600
LPILDADEYF HCAFGDYDSL AHVEGPHVAC VTPPQDQVPL NPPGTDHVTV
610 620 630 640 650
PLALMFEDVT VAATNFSFYD CSAVQALEAA APCRACVGSI WRCHWCPQSS
660 670 680 690 700
HCVYGEHCPE GERTIYSAQE VDIQVRGPGA CPQVEGLAGP HLVPVGWESH
710 720 730 740 750
LALRVRNLQH FRGLPASFHC WLELPGELRG LPATLEETAG DSGLIHCQAH
760 770 780 790 800
QFYPSMSQRE LPVPIYVTQG EAQRLDNTHA LYVILYDCAM GHPDCSHCQA
810 820 830 840 850
ANRSLGCLWC ADGQPACRYG PLCPPGAVEL LCPAPSIDAV EPLTGPPEGG
860 870 880 890 900
LALTILGSNL GRAFADVQYA VSVASRPCNP EPSLYRTSAR IVCVTSPAPN
910 920 930 940 950
GTTGPVRVAI KSQPPGISSQ HFTYQDPVLL SLSPRWGPQA GGTQLTIRGQ
960 970 980 990 1000
HLQTGGNTSA FVGGQPCPIL EPVCPEAIVC RTRPQAAPGE AAVLVVFGHA
1010 1020 1030 1040 1050
QRTLLASPFR YTANPQLVAA EPSASFRGGG RLIRVRGTGL DVVQRPLLSV
1060 1070 1080 1090 1100
WLEADAEVQA SRAQPQDPQP RRSCGAPAAD PQACIQLGGG LLQCSTVCSV
1110 1120 1130 1140 1150
NSSSLLLCRS PAVPDRAHPQ RVFFTLDNVQ VDFASASGGQ GFLYQPNPRL
1160 1170 1180 1190 1200
APLSREGPAR PYRLKPGHVL DVEGEGLNLG ISKEEVRVHI GRGECLVKTL
1210 1220 1230 1240 1250
TRTHLYCEPP AHAPQPANGS GLPQFVVQMG NVQLALGPVQ YEAEPPLSAF
1260 1270 1280 1290 1300
PVEAQAGVGM GAAVLIAAVL LLTLMYRHKS KQALRDYQKV LVQLESLETG
1310 1320 1330 1340 1350
VGDQCRKEFT DLMTEMTDLS SDLEGSGIPF LDYRTYAERA FFPGHGGCPL
1360 1370 1380 1390 1400
QPKPEGPGED GHCATVRQGL TQLSNLLNSK LFLLTLIHTL EEQPSFSQRD
1410 1420 1430 1440 1450
RCHVASLLSL ALHGKLEYLT DIMRTLLGDL AAHYVHRNPK LMLRRTETMV
1460 1470 1480 1490 1500
EKLLTNWLSI CLYAFLREVA GEPLYMLFRA IQYQVDKGPV DAVTGKAKRT
1510 1520 1530 1540 1550
LNDSRLLRED VEFQPLTLMV LVGPGAGGAA GSSEMQRVPA RVLDTDTITQ
1560 1570 1580 1590 1600
VKEKVLDQVY KGTPFSQRPS VHALDLEWRS GLAGHLTLSD EDLTSVTQNH
1610 1620 1630 1640 1650
WKRLNTLQHY KVPDGATVGL VPQLHRGSTI SQSLAQRCPL GENIPTLEDG
1660 1670 1680 1690 1700
EEGGVCLWHL VKATEEPEGA KVRCSSLRER EPARAKAIPE IYLTRLLSMK
1710 1720 1730 1740 1750
GTLQKFVDDT FQAILSVNRP IPIAVKYLFD LLDELAEKHG IEDPGTLHIW
1760 1770 1780 1790 1800
KTNSLLLRFW VNALKNPQLI FDVRVSDNVD AILAVIAQTF IDSCTTSEHK
1810 1820 1830 1840 1850
VGRDSPVNKL LYAREIPRYK QMVERYYADI RQSSPASYQE MNSALAELSG
1860 1870 1880 1890 1900
NYTSAPHCLE ALQELYNHIH RYYDQIISAL EEDPVGQKLQ LACRLQQVAA

LVENKVTDL
Length:1,909
Mass (Da):206,847
Last modified:August 31, 2004 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i11753CD58C7AC226
GO
Isoform 2 (identifier: Q9ULL4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-15: MCHAAQETPLLHHFM → MELTPASSLTCSLLSPRLPGSFPQLRRVPPCSRPWLPK

Show »
Length:1,932
Mass (Da):209,301
Checksum:iBA26AFFF478B979B
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H7BZV5H7BZV5_HUMAN
Plexin-B3
PLXNB3
258Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C3L0H7C3L0_HUMAN
Plexin-B3
PLXNB3
175Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C0P4H7C0P4_HUMAN
Plexin-B3
PLXNB3
163Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAA86520 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti149A → V in BAH12182 (PubMed:14702039).Curated1
Sequence conflicti300L → P in BAH12182 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_050601126A → T. Corresponds to variant dbSNP:rs34360382Ensembl.1
Natural variantiVAR_079495550R → Q1 PublicationCorresponds to variant dbSNP:rs782213788Ensembl.1
Natural variantiVAR_019681598V → I1 PublicationCorresponds to variant dbSNP:rs2266879Ensembl.1
Natural variantiVAR_0615381156E → D1 PublicationCorresponds to variant dbSNP:rs6643791Ensembl.1
Natural variantiVAR_0196821535M → T1 PublicationCorresponds to variant dbSNP:rs5987155Ensembl.1
Natural variantiVAR_0688071651E → A. Corresponds to variant dbSNP:rs34762690Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0444671 – 15MCHAA…LHHFM → MELTPASSLTCSLLSPRLPG SFPQLRRVPPCSRPWLPK in isoform 2. 1 PublicationAdd BLAST15

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF149019 mRNA Translation: AAG01376.1
AB033032 mRNA Translation: BAA86520.1 Different initiation.
AK295762 mRNA Translation: BAH12182.1
U52111 Genomic DNA No translation available.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS14729.1 [Q9ULL4-1]
CCDS55536.1 [Q9ULL4-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001156729.1, NM_001163257.1 [Q9ULL4-2]
NP_005384.2, NM_005393.2 [Q9ULL4-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000361971; ENSP00000355378; ENSG00000198753 [Q9ULL4-1]
ENST00000538966; ENSP00000442736; ENSG00000198753 [Q9ULL4-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
5365

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:5365

UCSC genome browser

More...
UCSCi
uc004fii.3 human [Q9ULL4-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF149019 mRNA Translation: AAG01376.1
AB033032 mRNA Translation: BAA86520.1 Different initiation.
AK295762 mRNA Translation: BAH12182.1
U52111 Genomic DNA No translation available.
CCDSiCCDS14729.1 [Q9ULL4-1]
CCDS55536.1 [Q9ULL4-2]
RefSeqiNP_001156729.1, NM_001163257.1 [Q9ULL4-2]
NP_005384.2, NM_005393.2 [Q9ULL4-1]

3D structure databases

SMRiQ9ULL4
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi111378, 7 interactors
IntActiQ9ULL4, 11 interactors
MINTiQ9ULL4
STRINGi9606.ENSP00000442736

PTM databases

GlyConnecti1614
iPTMnetiQ9ULL4
PhosphoSitePlusiQ9ULL4

Polymorphism and mutation databases

BioMutaiPLXNB3
DMDMi51701857

Proteomic databases

EPDiQ9ULL4
jPOSTiQ9ULL4
PaxDbiQ9ULL4
PeptideAtlasiQ9ULL4
PRIDEiQ9ULL4
ProteomicsDBi85069

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
5365
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000361971; ENSP00000355378; ENSG00000198753 [Q9ULL4-1]
ENST00000538966; ENSP00000442736; ENSG00000198753 [Q9ULL4-2]
GeneIDi5365
KEGGihsa:5365
UCSCiuc004fii.3 human [Q9ULL4-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
5365
DisGeNETi5365

GeneCards: human genes, protein and diseases

More...
GeneCardsi
PLXNB3

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0093726
HGNCiHGNC:9105 PLXNB3
HPAiHPA048046
MIMi300214 gene
neXtProtiNX_Q9ULL4
OpenTargetsiENSG00000198753
PharmGKBiPA33431

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3610 Eukaryota
ENOG410XR88 LUCA
GeneTreeiENSGT00950000182830
HOGENOMiHOG000231376
InParanoidiQ9ULL4
KOiK06821
OMAiHGQHLQT
OrthoDBi90434at2759
PhylomeDBiQ9ULL4
TreeFamiTF312962

Enzyme and pathway databases

ReactomeiR-HSA-416700 Other semaphorin interactions
SignaLinkiQ9ULL4

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
PLXNB3 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
PLXNB3

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
5365

Protein Ontology

More...
PROi
PR:Q9ULL4

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000198753 Expressed in 89 organ(s), highest expression level in substantia nigra
ExpressionAtlasiQ9ULL4 baseline and differential
GenevisibleiQ9ULL4 HS

Family and domain databases

Gene3Di2.130.10.10, 1 hit
2.60.40.10, 4 hits
InterProiView protein in InterPro
IPR013783 Ig-like_fold
IPR014756 Ig_E-set
IPR002909 IPT_dom
IPR031148 Plexin
IPR013548 Plexin_cytoplasmic_RasGAP_dom
IPR002165 Plexin_repeat
IPR016201 PSI
IPR008936 Rho_GTPase_activation_prot
IPR001627 Semap_dom
IPR036352 Semap_dom_sf
IPR041019 TIG1_plexin
IPR041362 TIG2_plexin
IPR015943 WD40/YVTN_repeat-like_dom_sf
PANTHERiPTHR22625 PTHR22625, 1 hit
PfamiView protein in Pfam
PF08337 Plexin_cytopl, 1 hit
PF01437 PSI, 1 hit
PF01403 Sema, 1 hit
PF01833 TIG, 3 hits
PF18020 TIG_2, 1 hit
PF17960 TIG_plexin, 1 hit
SMARTiView protein in SMART
SM00429 IPT, 3 hits
SM00423 PSI, 3 hits
SM00630 Sema, 1 hit
SUPFAMiSSF101912 SSF101912, 1 hit
SSF48350 SSF48350, 1 hit
SSF81296 SSF81296, 4 hits
PROSITEiView protein in PROSITE
PS51004 SEMA, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPLXB3_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9ULL4
Secondary accession number(s): B7Z3E6, F5H773, Q9HDA4
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 31, 2004
Last sequence update: August 31, 2004
Last modified: May 8, 2019
This is version 155 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again