Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Plexin-B3

Gene

PLXNB3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Receptor for SEMA5A that plays a role in axon guidance, invasive growth and cell migration. Stimulates neurite outgrowth and mediates Ca2+/Mg2+-dependent cell aggregation. In glioma cells, SEMA5A stimulation of PLXNB3 results in the disassembly of F-actin stress fibers, disruption of focal adhesions and cellular collapse as well as inhibition of cell migration and invasion through ARHGDIA-mediated inactivation of RAC1.3 Publications

GO - Molecular functioni

  • cell-cell adhesion mediator activity Source: ParkinsonsUK-UCL
  • protein domain specific binding Source: UniProtKB
  • Rho GDP-dissociation inhibitor binding Source: Ensembl
  • semaphorin receptor activity Source: UniProtKB

GO - Biological processi

Keywordsi

Molecular functionReceptor
Biological processNeurogenesis

Enzyme and pathway databases

ReactomeiR-HSA-416700 Other semaphorin interactions
SignaLinkiQ9ULL4

Names & Taxonomyi

Protein namesi
Recommended name:
Plexin-B3
Gene namesi
Name:PLXNB3
Synonyms:KIAA1206, PLXN6
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome X

Organism-specific databases

EuPathDBiHostDB:ENSG00000198753.11
HGNCiHGNC:9105 PLXNB3
MIMi300214 gene
neXtProtiNX_Q9ULL4

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini45 – 1255ExtracellularSequence analysisAdd BLAST1211
Transmembranei1256 – 1276HelicalSequence analysisAdd BLAST21
Topological domaini1277 – 1909CytoplasmicSequence analysisAdd BLAST633

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi5365
OpenTargetsiENSG00000198753
PharmGKBiPA33431

Polymorphism and mutation databases

BioMutaiPLXNB3
DMDMi51701857

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 44Sequence analysisAdd BLAST44
ChainiPRO_000002467445 – 1909Plexin-B3Add BLAST1865

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi51N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi98 ↔ 107PROSITE-ProRule annotation
Disulfide bondi132 ↔ 140PROSITE-ProRule annotation
Glycosylationi231N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi267 ↔ 370PROSITE-ProRule annotation
Disulfide bondi283 ↔ 315PROSITE-ProRule annotation
Disulfide bondi333 ↔ 357PROSITE-ProRule annotation
Disulfide bondi474 ↔ 491PROSITE-ProRule annotation
Disulfide bondi480 ↔ 525PROSITE-ProRule annotation
Disulfide bondi483 ↔ 500PROSITE-ProRule annotation
Disulfide bondi494 ↔ 506PROSITE-ProRule annotation
Disulfide bondi562 ↔ 580PROSITE-ProRule annotation
Glycosylationi615N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi802N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi900N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi957N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi1101N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi1218N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

EPDiQ9ULL4
PaxDbiQ9ULL4
PeptideAtlasiQ9ULL4
PRIDEiQ9ULL4
ProteomicsDBi85069

PTM databases

GlyConnecti1614
iPTMnetiQ9ULL4
PhosphoSitePlusiQ9ULL4

Expressioni

Tissue specificityi

Expression detected in Purkinje and granular cells in cerebellum, and in brain neocortex but not in corpus callosum. Expressed in glioma cells and embryonic kidney cells (at protein level). Expressed in brain, liver, pancreas and placenta, with weak expression detected also in lung and kidney. Expressed in several glioma cell lines.3 Publications

Gene expression databases

BgeeiENSG00000198753 Expressed in 89 organ(s), highest expression level in substantia nigra
CleanExiHS_PLXNB3
ExpressionAtlasiQ9ULL4 baseline and differential
GenevisibleiQ9ULL4 HS

Organism-specific databases

HPAiHPA048046

Interactioni

Subunit structurei

Interacts (via cytoplasmic domain) with RAC1 and ARHGDIA (By similarity). Binds MET and MST1R. Interacts (via cytoplasmic domain) with FSCN1. Interacts with RIT2/RIN. May form homodimers (via Sema domain).By similarity3 Publications

Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

BioGridi111378, 6 interactors
IntActiQ9ULL4, 11 interactors
MINTiQ9ULL4
STRINGi9606.ENSP00000442736

Structurei

3D structure databases

ProteinModelPortaliQ9ULL4
SMRiQ9ULL4
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini45 – 471SemaPROSITE-ProRule annotationAdd BLAST427
Domaini473 – 526PSI 1Add BLAST54
Domaini620 – 682PSI 2Add BLAST63
Domaini787 – 833PSI 3Add BLAST47
Domaini835 – 925IPT/TIG 1Add BLAST91
Domaini927 – 1012IPT/TIG 2Add BLAST86
Domaini1015 – 1145IPT/TIG 3Add BLAST131
Domaini1159 – 1244IPT/TIG 4Add BLAST86

Sequence similaritiesi

Belongs to the plexin family.Curated

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG3610 Eukaryota
ENOG410XR88 LUCA
GeneTreeiENSGT00760000119048
HOGENOMiHOG000231376
HOVERGENiHBG053404
InParanoidiQ9ULL4
KOiK06821
OMAiCGDEHTP
OrthoDBiEOG091G00EK
PhylomeDBiQ9ULL4
TreeFamiTF312962

Family and domain databases

Gene3Di2.130.10.10, 1 hit
2.60.40.10, 4 hits
InterProiView protein in InterPro
IPR013783 Ig-like_fold
IPR014756 Ig_E-set
IPR002909 IPT_dom
IPR031148 Plexin
IPR013548 Plexin_cytoplasmic_RasGAP_dom
IPR002165 Plexin_repeat
IPR016201 PSI
IPR008936 Rho_GTPase_activation_prot
IPR001627 Semap_dom
IPR036352 Semap_dom_sf
IPR015943 WD40/YVTN_repeat-like_dom_sf
PANTHERiPTHR22625 PTHR22625, 1 hit
PfamiView protein in Pfam
PF08337 Plexin_cytopl, 1 hit
PF01437 PSI, 1 hit
PF01403 Sema, 1 hit
PF01833 TIG, 3 hits
SMARTiView protein in SMART
SM00429 IPT, 3 hits
SM00423 PSI, 3 hits
SM00630 Sema, 1 hit
SUPFAMiSSF101912 SSF101912, 1 hit
SSF48350 SSF48350, 2 hits
SSF81296 SSF81296, 5 hits
PROSITEiView protein in PROSITE
PS51004 SEMA, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9ULL4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MCHAAQETPL LHHFMAPVMA RWPPFGLCLL LLLLSPPPLP LTGAHRFSAP
60 70 80 90 100
NTTLNHLALA PGRGTLYVGA VNRLFQLSPE LQLEAVAVTG PVIDSPDCVP
110 120 130 140 150
FRDPAECPQA QLTDNANQLL LVSSRAQELV ACGQVRQGVC ETRRLGDVAE
160 170 180 190 200
VLYQAEDPGD GQFVAANTPG VATVGLVVPL PGRDLLLVAR GLAGKLSAGV
210 220 230 240 250
PPLAIRQLAG SQPFSSEGLG RLVVGDFSDY NNSYVGAFAD ARSAYFVFRR
260 270 280 290 300
RGARAQAEYR SYVARVCLGD TNLYSYVEVP LACQGQGLIQ AAFLAPGTLL
310 320 330 340 350
GVFAAGPRGT QAALCAFPMV ELGASMEQAR RLCYTAGGRG PSGAEEATVE
360 370 380 390 400
YGVTSRCVTL PLDSPESYPC GDEHTPSPIA GRQPLEVQPL LKLGQPVSAV
410 420 430 440 450
AALQADGHMI AFLGDTQGQL YKVFLHGSQG QVYHSQQVGP PGSAISPDLL
460 470 480 490 500
LDSSGSHLYV LTAHQVDRIP VAACPQFPDC ASCLQAQDPL CGWCVLQGRC
510 520 530 540 550
TRKGQCGRAG QLNQWLWSYE EDSHCLHIQS LLPGHHPRQE QGQVTLSVPR
560 570 580 590 600
LPILDADEYF HCAFGDYDSL AHVEGPHVAC VTPPQDQVPL NPPGTDHVTV
610 620 630 640 650
PLALMFEDVT VAATNFSFYD CSAVQALEAA APCRACVGSI WRCHWCPQSS
660 670 680 690 700
HCVYGEHCPE GERTIYSAQE VDIQVRGPGA CPQVEGLAGP HLVPVGWESH
710 720 730 740 750
LALRVRNLQH FRGLPASFHC WLELPGELRG LPATLEETAG DSGLIHCQAH
760 770 780 790 800
QFYPSMSQRE LPVPIYVTQG EAQRLDNTHA LYVILYDCAM GHPDCSHCQA
810 820 830 840 850
ANRSLGCLWC ADGQPACRYG PLCPPGAVEL LCPAPSIDAV EPLTGPPEGG
860 870 880 890 900
LALTILGSNL GRAFADVQYA VSVASRPCNP EPSLYRTSAR IVCVTSPAPN
910 920 930 940 950
GTTGPVRVAI KSQPPGISSQ HFTYQDPVLL SLSPRWGPQA GGTQLTIRGQ
960 970 980 990 1000
HLQTGGNTSA FVGGQPCPIL EPVCPEAIVC RTRPQAAPGE AAVLVVFGHA
1010 1020 1030 1040 1050
QRTLLASPFR YTANPQLVAA EPSASFRGGG RLIRVRGTGL DVVQRPLLSV
1060 1070 1080 1090 1100
WLEADAEVQA SRAQPQDPQP RRSCGAPAAD PQACIQLGGG LLQCSTVCSV
1110 1120 1130 1140 1150
NSSSLLLCRS PAVPDRAHPQ RVFFTLDNVQ VDFASASGGQ GFLYQPNPRL
1160 1170 1180 1190 1200
APLSREGPAR PYRLKPGHVL DVEGEGLNLG ISKEEVRVHI GRGECLVKTL
1210 1220 1230 1240 1250
TRTHLYCEPP AHAPQPANGS GLPQFVVQMG NVQLALGPVQ YEAEPPLSAF
1260 1270 1280 1290 1300
PVEAQAGVGM GAAVLIAAVL LLTLMYRHKS KQALRDYQKV LVQLESLETG
1310 1320 1330 1340 1350
VGDQCRKEFT DLMTEMTDLS SDLEGSGIPF LDYRTYAERA FFPGHGGCPL
1360 1370 1380 1390 1400
QPKPEGPGED GHCATVRQGL TQLSNLLNSK LFLLTLIHTL EEQPSFSQRD
1410 1420 1430 1440 1450
RCHVASLLSL ALHGKLEYLT DIMRTLLGDL AAHYVHRNPK LMLRRTETMV
1460 1470 1480 1490 1500
EKLLTNWLSI CLYAFLREVA GEPLYMLFRA IQYQVDKGPV DAVTGKAKRT
1510 1520 1530 1540 1550
LNDSRLLRED VEFQPLTLMV LVGPGAGGAA GSSEMQRVPA RVLDTDTITQ
1560 1570 1580 1590 1600
VKEKVLDQVY KGTPFSQRPS VHALDLEWRS GLAGHLTLSD EDLTSVTQNH
1610 1620 1630 1640 1650
WKRLNTLQHY KVPDGATVGL VPQLHRGSTI SQSLAQRCPL GENIPTLEDG
1660 1670 1680 1690 1700
EEGGVCLWHL VKATEEPEGA KVRCSSLRER EPARAKAIPE IYLTRLLSMK
1710 1720 1730 1740 1750
GTLQKFVDDT FQAILSVNRP IPIAVKYLFD LLDELAEKHG IEDPGTLHIW
1760 1770 1780 1790 1800
KTNSLLLRFW VNALKNPQLI FDVRVSDNVD AILAVIAQTF IDSCTTSEHK
1810 1820 1830 1840 1850
VGRDSPVNKL LYAREIPRYK QMVERYYADI RQSSPASYQE MNSALAELSG
1860 1870 1880 1890 1900
NYTSAPHCLE ALQELYNHIH RYYDQIISAL EEDPVGQKLQ LACRLQQVAA

LVENKVTDL
Length:1,909
Mass (Da):206,847
Last modified:August 31, 2004 - v2
Checksum:i11753CD58C7AC226
GO
Isoform 2 (identifier: Q9ULL4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-15: MCHAAQETPLLHHFM → MELTPASSLTCSLLSPRLPGSFPQLRRVPPCSRPWLPK

Show »
Length:1,932
Mass (Da):209,301
Checksum:iBA26AFFF478B979B
GO

Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H7BZV5H7BZV5_HUMAN
Plexin-B3
PLXNB3
258Annotation score:
H7C3L0H7C3L0_HUMAN
Plexin-B3
PLXNB3
175Annotation score:
H7C0P4H7C0P4_HUMAN
Plexin-B3
PLXNB3
163Annotation score:

Sequence cautioni

The sequence BAA86520 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti149A → V in BAH12182 (PubMed:14702039).Curated1
Sequence conflicti300L → P in BAH12182 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_050601126A → T. Corresponds to variant dbSNP:rs34360382Ensembl.1
Natural variantiVAR_079495550R → Q1 PublicationCorresponds to variant dbSNP:rs782213788Ensembl.1
Natural variantiVAR_019681598V → I1 PublicationCorresponds to variant dbSNP:rs2266879Ensembl.1
Natural variantiVAR_0615381156E → D1 PublicationCorresponds to variant dbSNP:rs6643791Ensembl.1
Natural variantiVAR_0196821535M → T1 PublicationCorresponds to variant dbSNP:rs5987155Ensembl.1
Natural variantiVAR_0688071651E → A. Corresponds to variant dbSNP:rs34762690Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0444671 – 15MCHAA…LHHFM → MELTPASSLTCSLLSPRLPG SFPQLRRVPPCSRPWLPK in isoform 2. 1 PublicationAdd BLAST15

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF149019 mRNA Translation: AAG01376.1
AB033032 mRNA Translation: BAA86520.1 Different initiation.
AK295762 mRNA Translation: BAH12182.1
U52111 Genomic DNA No translation available.
CCDSiCCDS14729.1 [Q9ULL4-1]
CCDS55536.1 [Q9ULL4-2]
RefSeqiNP_001156729.1, NM_001163257.1 [Q9ULL4-2]
NP_005384.2, NM_005393.2 [Q9ULL4-1]
UniGeneiHs.632833

Genome annotation databases

EnsembliENST00000361971; ENSP00000355378; ENSG00000198753 [Q9ULL4-1]
ENST00000538966; ENSP00000442736; ENSG00000198753 [Q9ULL4-2]
GeneIDi5365
KEGGihsa:5365
UCSCiuc004fii.3 human [Q9ULL4-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF149019 mRNA Translation: AAG01376.1
AB033032 mRNA Translation: BAA86520.1 Different initiation.
AK295762 mRNA Translation: BAH12182.1
U52111 Genomic DNA No translation available.
CCDSiCCDS14729.1 [Q9ULL4-1]
CCDS55536.1 [Q9ULL4-2]
RefSeqiNP_001156729.1, NM_001163257.1 [Q9ULL4-2]
NP_005384.2, NM_005393.2 [Q9ULL4-1]
UniGeneiHs.632833

3D structure databases

ProteinModelPortaliQ9ULL4
SMRiQ9ULL4
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi111378, 6 interactors
IntActiQ9ULL4, 11 interactors
MINTiQ9ULL4
STRINGi9606.ENSP00000442736

PTM databases

GlyConnecti1614
iPTMnetiQ9ULL4
PhosphoSitePlusiQ9ULL4

Polymorphism and mutation databases

BioMutaiPLXNB3
DMDMi51701857

Proteomic databases

EPDiQ9ULL4
PaxDbiQ9ULL4
PeptideAtlasiQ9ULL4
PRIDEiQ9ULL4
ProteomicsDBi85069

Protocols and materials databases

DNASUi5365
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000361971; ENSP00000355378; ENSG00000198753 [Q9ULL4-1]
ENST00000538966; ENSP00000442736; ENSG00000198753 [Q9ULL4-2]
GeneIDi5365
KEGGihsa:5365
UCSCiuc004fii.3 human [Q9ULL4-1]

Organism-specific databases

CTDi5365
DisGeNETi5365
EuPathDBiHostDB:ENSG00000198753.11
GeneCardsiPLXNB3
H-InvDBiHIX0093726
HGNCiHGNC:9105 PLXNB3
HPAiHPA048046
MIMi300214 gene
neXtProtiNX_Q9ULL4
OpenTargetsiENSG00000198753
PharmGKBiPA33431
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3610 Eukaryota
ENOG410XR88 LUCA
GeneTreeiENSGT00760000119048
HOGENOMiHOG000231376
HOVERGENiHBG053404
InParanoidiQ9ULL4
KOiK06821
OMAiCGDEHTP
OrthoDBiEOG091G00EK
PhylomeDBiQ9ULL4
TreeFamiTF312962

Enzyme and pathway databases

ReactomeiR-HSA-416700 Other semaphorin interactions
SignaLinkiQ9ULL4

Miscellaneous databases

ChiTaRSiPLXNB3 human
GeneWikiiPLXNB3
GenomeRNAii5365
PROiPR:Q9ULL4
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000198753 Expressed in 89 organ(s), highest expression level in substantia nigra
CleanExiHS_PLXNB3
ExpressionAtlasiQ9ULL4 baseline and differential
GenevisibleiQ9ULL4 HS

Family and domain databases

Gene3Di2.130.10.10, 1 hit
2.60.40.10, 4 hits
InterProiView protein in InterPro
IPR013783 Ig-like_fold
IPR014756 Ig_E-set
IPR002909 IPT_dom
IPR031148 Plexin
IPR013548 Plexin_cytoplasmic_RasGAP_dom
IPR002165 Plexin_repeat
IPR016201 PSI
IPR008936 Rho_GTPase_activation_prot
IPR001627 Semap_dom
IPR036352 Semap_dom_sf
IPR015943 WD40/YVTN_repeat-like_dom_sf
PANTHERiPTHR22625 PTHR22625, 1 hit
PfamiView protein in Pfam
PF08337 Plexin_cytopl, 1 hit
PF01437 PSI, 1 hit
PF01403 Sema, 1 hit
PF01833 TIG, 3 hits
SMARTiView protein in SMART
SM00429 IPT, 3 hits
SM00423 PSI, 3 hits
SM00630 Sema, 1 hit
SUPFAMiSSF101912 SSF101912, 1 hit
SSF48350 SSF48350, 2 hits
SSF81296 SSF81296, 5 hits
PROSITEiView protein in PROSITE
PS51004 SEMA, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiPLXB3_HUMAN
AccessioniPrimary (citable) accession number: Q9ULL4
Secondary accession number(s): B7Z3E6, F5H773, Q9HDA4
Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 31, 2004
Last sequence update: August 31, 2004
Last modified: October 10, 2018
This is version 149 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again