Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein BCAP

Gene

ODF2L

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Acts as a suppressor of ciliogenesis, specifically, the initiation of ciliogenesis.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

  • cell projection organization Source: UniProtKB-KW
  • negative regulation of cilium assembly Source: UniProtKB

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processCilium biogenesis/degradation

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Protein BCAPCurated
Alternative name(s):
Basal body centriole-associated protein1 Publication
Outer dense fiber protein 2-like
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ODF2LImported
Synonyms:BCAP1 Publication, KIAA1229
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000122417.15

Human Gene Nomenclature Database

More...
HGNCi
HGNC:29225 ODF2L

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9ULJ1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell projection, Cytoplasm, Cytoskeleton

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000122417

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA142671232

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ODF2L

Domain mapping of disease mutations (DMDM)

More...
DMDMi
160013283

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003089091 – 636Protein BCAPAdd BLAST636

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9ULJ1

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9ULJ1

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9ULJ1

PeptideAtlas

More...
PeptideAtlasi
Q9ULJ1

PRoteomics IDEntifications database

More...
PRIDEi
Q9ULJ1

ProteomicsDB human proteome resource

More...
ProteomicsDBi
85040
85041 [Q9ULJ1-2]
85042 [Q9ULJ1-3]
85043 [Q9ULJ1-4]
85044 [Q9ULJ1-5]
85045 [Q9ULJ1-6]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9ULJ1

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9ULJ1

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Mainly expressed in trachea and testis. Not detected in bone marrow, bladder, leukocytes. Only weakly detected in tongue, stomach, brain and ovaries.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000122417 Expressed in 180 organ(s), highest expression level in intestine

CleanEx database of gene expression profiles

More...
CleanExi
HS_ODF2L

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9ULJ1 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9ULJ1 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA028020
HPA028095
HPA028333

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
121557, 19 interactors

Protein interaction database and analysis system

More...
IntActi
Q9ULJ1, 29 interactors

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q9ULJ1

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9ULJ1

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili36 – 97Sequence analysisAdd BLAST62
Coiled coili141 – 220Sequence analysisAdd BLAST80
Coiled coili249 – 325Sequence analysisAdd BLAST77
Coiled coili377 – 484Sequence analysisAdd BLAST108
Coiled coili519 – 631Sequence analysisAdd BLAST113

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the ODF2 family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IJHH Eukaryota
ENOG410YEYY LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00530000063497

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG054948

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9ULJ1

Identification of Orthologs from Complete Genome Data

More...
OMAi
CADQAHT

Database of Orthologous Groups

More...
OrthoDBi
328077at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9ULJ1

TreeFam database of animal gene trees

More...
TreeFami
TF328605

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR026102 BCAP
IPR026099 Odf2-rel

The PANTHER Classification System

More...
PANTHERi
PTHR23162 PTHR23162, 1 hit
PTHR23162:SF7 PTHR23162:SF7, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 6 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 7 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9ULJ1-1) [UniParc]FASTAAdd to basket
Also known as: L-BCAP1 Publication

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEKAVNDGSH SEELFCHLKT ISEKEDLPRC TSESHLSCLK QDILNEKTEL
60 70 80 90 100
EATLKEAELV THSVELLLPL FKDTIEKINF ENANLSALNL KISEQKEILI
110 120 130 140 150
KELDTFKSVK LALEHLLRKR DYKQTGDNLS SMLLENLTDN ESENTNLKKK
160 170 180 190 200
VFEKEAHIQE LSCLFQSEKA NTLKANRFSQ SVKVVHERLQ IQIHKREAEN
210 220 230 240 250
DKLKEYVKSL ETKIAKWNLQ SRMNKNEAIV MKEASRQKTV ALKKASKVYK
260 270 280 290 300
QRLDHFTGAI EKLTSQIRDQ EAKLSETISA SNAWKSHYEK IVIEKTELEV
310 320 330 340 350
QIETMKKQII NLLEDLKKME DHGKNSCEEI LRKVHSIEYE NETLNLENTK
360 370 380 390 400
LKLRFPCRIT ESKNMNILIV LDMLCYISSE KTTLAALKDE VVSVENELSE
410 420 430 440 450
LQEVEKKQKT LIEMYKTQVQ KLQEAAEIVK SRCENLLHKN NQITKTKNKN
460 470 480 490 500
VEKMRGQMES HLKELERVCD SLTAAERRLH ECQESLQCCK GKCADQEHTI
510 520 530 540 550
RELQGQVDGN HNLLTKLSLE EENCLIQLKC ENLQQKLEQM DAENKELEKK
560 570 580 590 600
LANQEECLKH SNLKFKEKSA EYTALARQLE AALEEGRQKV AEEIEKMSSR
610 620 630
ESALQIKILD LETELRKKNE EQNQLVCKMN SDPETP
Length:636
Mass (Da):73,728
Last modified:October 23, 2007 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iD74FAB4F22F21581
GO
Isoform 2 (identifier: Q9ULJ1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     454-506: Missing.
     632-636: DPETP → KAQHQEVCLKEVQNSLEKSENQNESIKNYLQFLKTSYVTMFE

Show »
Length:620
Mass (Da):72,053
Checksum:i08EEED881F4457B5
GO
Isoform 3 (identifier: Q9ULJ1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     353-381: Missing.
     506-506: Q → QILKQWEEYSVLAW

Show »
Length:620
Mass (Da):71,962
Checksum:i10437F28D20EAB06
GO
Isoform 4 (identifier: Q9ULJ1-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     353-381: Missing.
     632-636: DPETP → KAQHQEVCLKEVQNSLEKSENQNESIKNYLQFLKTSYVTMFE

Show »
Length:644
Mass (Da):74,765
Checksum:iC7F94FF7790D8FF1
GO
Isoform 5 (identifier: Q9ULJ1-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-131: Missing.
     353-381: Missing.
     632-636: DPETP → KAQHQEVCLKEVQNSLEKSENQNESIKNYLQFLKTSYVTMFE

Show »
Length:513
Mass (Da):59,803
Checksum:i056290F9824311AD
GO
Isoform 6 (identifier: Q9ULJ1-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     353-381: Missing.
     454-506: Missing.
     632-636: DPETP → KAQHQEVCLKEVQNSLEKSENQNESIKNYLQFLKTSYVTMFE

Show »
Length:591
Mass (Da):68,639
Checksum:iCEB4025EB317F8FD
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 7 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9PNP0E9PNP0_HUMAN
Protein BCAP
ODF2L
243Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YF19H0YF19_HUMAN
Protein BCAP
ODF2L
153Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YD68H0YD68_HUMAN
Protein BCAP
ODF2L
520Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B5ME44B5ME44_HUMAN
Protein BCAP
ODF2L
49Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YCM1H0YCM1_HUMAN
Protein BCAP
ODF2L
54Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PJZ1E9PJZ1_HUMAN
Protein BCAP
ODF2L
43Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PMV9E9PMV9_HUMAN
Protein BCAP
ODF2L
60Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH29420 differs from that shown. Contaminating sequence. Potential poly-A sequence.Curated
The sequence AAH47368 differs from that shown. Reason: Erroneous termination at position 397. Translated as Glu.Curated
The sequence AK308351 differs from that shown. Reason: Frameshift at position 296.Curated
The sequence BAA86543 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti135E → G in AAH47368 (PubMed:15489334).Curated1
Sequence conflicti203L → S in AAH29420 (PubMed:15489334).Curated1
Sequence conflicti339Y → H in BAA86543 (PubMed:10574462).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_036882177R → H. Corresponds to variant dbSNP:rs12032435Ensembl.1
Natural variantiVAR_036883350K → R1 PublicationCorresponds to variant dbSNP:rs17854440Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0409301 – 131Missing in isoform 5. 1 PublicationAdd BLAST131
Alternative sequenceiVSP_029057353 – 381Missing in isoform 3, isoform 4, isoform 5 and isoform 6. 3 PublicationsAdd BLAST29
Alternative sequenceiVSP_029058454 – 506Missing in isoform 2 and isoform 6. 2 PublicationsAdd BLAST53
Alternative sequenceiVSP_029059506Q → QILKQWEEYSVLAW in isoform 3. 1 Publication1
Alternative sequenceiVSP_029060632 – 636DPETP → KAQHQEVCLKEVQNSLEKSE NQNESIKNYLQFLKTSYVTM FE in isoform 2, isoform 4, isoform 5 and isoform 6. 3 Publications5

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB033055 mRNA Translation: BAA86543.1 Different initiation.
AK303209 mRNA Translation: BAG64299.1
AK308351 mRNA No translation available.
CR591511 mRNA No translation available.
AC119749 Genomic DNA No translation available.
AL136382 Genomic DNA No translation available.
CH471097 Genomic DNA Translation: EAW73190.1
CH471097 Genomic DNA Translation: EAW73192.1
BC029420 mRNA Translation: AAH29420.1 Sequence problems.
BC047368 mRNA Translation: AAH47368.1 Sequence problems.
BC091490 mRNA Translation: AAH91490.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS30763.2 [Q9ULJ1-3]
CCDS41354.2 [Q9ULJ1-1]
CCDS53339.1 [Q9ULJ1-6]

NCBI Reference Sequences

More...
RefSeqi
NP_001007023.2, NM_001007022.2 [Q9ULJ1-1]
NP_001171694.1, NM_001184765.1 [Q9ULJ1-2]
NP_001171695.1, NM_001184766.1 [Q9ULJ1-6]
NP_065780.2, NM_020729.2 [Q9ULJ1-3]
XP_005271111.1, XM_005271054.3 [Q9ULJ1-4]
XP_011540121.1, XM_011541819.2 [Q9ULJ1-1]
XP_016857366.1, XM_017001877.1 [Q9ULJ1-4]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.149360

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000294678; ENSP00000294678; ENSG00000122417 [Q9ULJ1-3]
ENST00000317336; ENSP00000320165; ENSG00000122417 [Q9ULJ1-1]
ENST00000359242; ENSP00000359600; ENSG00000122417 [Q9ULJ1-1]
ENST00000370566; ENSP00000359597; ENSG00000122417 [Q9ULJ1-6]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
57489

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:57489

UCSC genome browser

More...
UCSCi
uc001dll.3 human [Q9ULJ1-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB033055 mRNA Translation: BAA86543.1 Different initiation.
AK303209 mRNA Translation: BAG64299.1
AK308351 mRNA No translation available.
CR591511 mRNA No translation available.
AC119749 Genomic DNA No translation available.
AL136382 Genomic DNA No translation available.
CH471097 Genomic DNA Translation: EAW73190.1
CH471097 Genomic DNA Translation: EAW73192.1
BC029420 mRNA Translation: AAH29420.1 Sequence problems.
BC047368 mRNA Translation: AAH47368.1 Sequence problems.
BC091490 mRNA Translation: AAH91490.1
CCDSiCCDS30763.2 [Q9ULJ1-3]
CCDS41354.2 [Q9ULJ1-1]
CCDS53339.1 [Q9ULJ1-6]
RefSeqiNP_001007023.2, NM_001007022.2 [Q9ULJ1-1]
NP_001171694.1, NM_001184765.1 [Q9ULJ1-2]
NP_001171695.1, NM_001184766.1 [Q9ULJ1-6]
NP_065780.2, NM_020729.2 [Q9ULJ1-3]
XP_005271111.1, XM_005271054.3 [Q9ULJ1-4]
XP_011540121.1, XM_011541819.2 [Q9ULJ1-1]
XP_016857366.1, XM_017001877.1 [Q9ULJ1-4]
UniGeneiHs.149360

3D structure databases

ProteinModelPortaliQ9ULJ1
SMRiQ9ULJ1
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi121557, 19 interactors
IntActiQ9ULJ1, 29 interactors

PTM databases

iPTMnetiQ9ULJ1
PhosphoSitePlusiQ9ULJ1

Polymorphism and mutation databases

BioMutaiODF2L
DMDMi160013283

Proteomic databases

EPDiQ9ULJ1
jPOSTiQ9ULJ1
PaxDbiQ9ULJ1
PeptideAtlasiQ9ULJ1
PRIDEiQ9ULJ1
ProteomicsDBi85040
85041 [Q9ULJ1-2]
85042 [Q9ULJ1-3]
85043 [Q9ULJ1-4]
85044 [Q9ULJ1-5]
85045 [Q9ULJ1-6]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000294678; ENSP00000294678; ENSG00000122417 [Q9ULJ1-3]
ENST00000317336; ENSP00000320165; ENSG00000122417 [Q9ULJ1-1]
ENST00000359242; ENSP00000359600; ENSG00000122417 [Q9ULJ1-1]
ENST00000370566; ENSP00000359597; ENSG00000122417 [Q9ULJ1-6]
GeneIDi57489
KEGGihsa:57489
UCSCiuc001dll.3 human [Q9ULJ1-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
57489
EuPathDBiHostDB:ENSG00000122417.15

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ODF2L
HGNCiHGNC:29225 ODF2L
HPAiHPA028020
HPA028095
HPA028333
neXtProtiNX_Q9ULJ1
OpenTargetsiENSG00000122417
PharmGKBiPA142671232

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IJHH Eukaryota
ENOG410YEYY LUCA
GeneTreeiENSGT00530000063497
HOVERGENiHBG054948
InParanoidiQ9ULJ1
OMAiCADQAHT
OrthoDBi328077at2759
PhylomeDBiQ9ULJ1
TreeFamiTF328605

Miscellaneous databases

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
57489

Protein Ontology

More...
PROi
PR:Q9ULJ1

Gene expression databases

BgeeiENSG00000122417 Expressed in 180 organ(s), highest expression level in intestine
CleanExiHS_ODF2L
ExpressionAtlasiQ9ULJ1 baseline and differential
GenevisibleiQ9ULJ1 HS

Family and domain databases

InterProiView protein in InterPro
IPR026102 BCAP
IPR026099 Odf2-rel
PANTHERiPTHR23162 PTHR23162, 1 hit
PTHR23162:SF7 PTHR23162:SF7, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiODF2L_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9ULJ1
Secondary accession number(s): A8MU56
, B4E037, Q05C40, Q5BJG5, Q5TBX3, Q5TBX4, Q86X31
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 23, 2007
Last sequence update: October 23, 2007
Last modified: January 16, 2019
This is version 118 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again