Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein BCAP

Gene

ODF2L

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

Acts as a suppressor of ciliogenesis, specifically, the initiation of ciliogenesis.1 Publication

GO - Biological processi

  • cell projection organization Source: UniProtKB-KW
  • negative regulation of cilium assembly Source: UniProtKB

Keywordsi

Biological processCilium biogenesis/degradation

Names & Taxonomyi

Protein namesi
Recommended name:
Protein BCAPCurated
Alternative name(s):
Basal body centriole-associated protein1 Publication
Outer dense fiber protein 2-like
Gene namesi
Name:ODF2LImported
Synonyms:BCAP1 Publication, KIAA1229
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

EuPathDBiHostDB:ENSG00000122417.15
HGNCiHGNC:29225 ODF2L
neXtProtiNX_Q9ULJ1

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell projection, Cytoplasm, Cytoskeleton

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000122417
PharmGKBiPA142671232

Polymorphism and mutation databases

BioMutaiODF2L
DMDMi160013283

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003089091 – 636Protein BCAPAdd BLAST636

Proteomic databases

EPDiQ9ULJ1
PaxDbiQ9ULJ1
PeptideAtlasiQ9ULJ1
PRIDEiQ9ULJ1
ProteomicsDBi85040
85041 [Q9ULJ1-2]
85042 [Q9ULJ1-3]
85043 [Q9ULJ1-4]
85044 [Q9ULJ1-5]
85045 [Q9ULJ1-6]

PTM databases

iPTMnetiQ9ULJ1
PhosphoSitePlusiQ9ULJ1

Expressioni

Tissue specificityi

Mainly expressed in trachea and testis. Not detected in bone marrow, bladder, leukocytes. Only weakly detected in tongue, stomach, brain and ovaries.1 Publication

Gene expression databases

BgeeiENSG00000122417 Expressed in 180 organ(s), highest expression level in intestine
CleanExiHS_ODF2L
ExpressionAtlasiQ9ULJ1 baseline and differential
GenevisibleiQ9ULJ1 HS

Organism-specific databases

HPAiHPA028020
HPA028095
HPA028333

Interactioni

Protein-protein interaction databases

BioGridi121557, 18 interactors
IntActiQ9ULJ1, 29 interactors

Structurei

3D structure databases

ProteinModelPortaliQ9ULJ1
SMRiQ9ULJ1
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili36 – 97Sequence analysisAdd BLAST62
Coiled coili141 – 220Sequence analysisAdd BLAST80
Coiled coili249 – 325Sequence analysisAdd BLAST77
Coiled coili377 – 484Sequence analysisAdd BLAST108
Coiled coili519 – 631Sequence analysisAdd BLAST113

Sequence similaritiesi

Belongs to the ODF2 family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiENOG410IJHH Eukaryota
ENOG410YEYY LUCA
GeneTreeiENSGT00530000063497
HOVERGENiHBG054948
InParanoidiQ9ULJ1
OMAiGKNSCEE
OrthoDBiEOG091G13KV
PhylomeDBiQ9ULJ1
TreeFamiTF328605

Family and domain databases

InterProiView protein in InterPro
IPR026102 BCAP
IPR026099 Odf2-rel
PANTHERiPTHR23162 PTHR23162, 1 hit
PTHR23162:SF7 PTHR23162:SF7, 1 hit

Sequences (6+)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 7 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9ULJ1-1) [UniParc]FASTAAdd to basket
Also known as: L-BCAP1 Publication

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEKAVNDGSH SEELFCHLKT ISEKEDLPRC TSESHLSCLK QDILNEKTEL
60 70 80 90 100
EATLKEAELV THSVELLLPL FKDTIEKINF ENANLSALNL KISEQKEILI
110 120 130 140 150
KELDTFKSVK LALEHLLRKR DYKQTGDNLS SMLLENLTDN ESENTNLKKK
160 170 180 190 200
VFEKEAHIQE LSCLFQSEKA NTLKANRFSQ SVKVVHERLQ IQIHKREAEN
210 220 230 240 250
DKLKEYVKSL ETKIAKWNLQ SRMNKNEAIV MKEASRQKTV ALKKASKVYK
260 270 280 290 300
QRLDHFTGAI EKLTSQIRDQ EAKLSETISA SNAWKSHYEK IVIEKTELEV
310 320 330 340 350
QIETMKKQII NLLEDLKKME DHGKNSCEEI LRKVHSIEYE NETLNLENTK
360 370 380 390 400
LKLRFPCRIT ESKNMNILIV LDMLCYISSE KTTLAALKDE VVSVENELSE
410 420 430 440 450
LQEVEKKQKT LIEMYKTQVQ KLQEAAEIVK SRCENLLHKN NQITKTKNKN
460 470 480 490 500
VEKMRGQMES HLKELERVCD SLTAAERRLH ECQESLQCCK GKCADQEHTI
510 520 530 540 550
RELQGQVDGN HNLLTKLSLE EENCLIQLKC ENLQQKLEQM DAENKELEKK
560 570 580 590 600
LANQEECLKH SNLKFKEKSA EYTALARQLE AALEEGRQKV AEEIEKMSSR
610 620 630
ESALQIKILD LETELRKKNE EQNQLVCKMN SDPETP
Length:636
Mass (Da):73,728
Last modified:October 23, 2007 - v2
Checksum:iD74FAB4F22F21581
GO
Isoform 2 (identifier: Q9ULJ1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     454-506: Missing.
     632-636: DPETP → KAQHQEVCLKEVQNSLEKSENQNESIKNYLQFLKTSYVTMFE

Show »
Length:620
Mass (Da):72,053
Checksum:i08EEED881F4457B5
GO
Isoform 3 (identifier: Q9ULJ1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     353-381: Missing.
     506-506: Q → QILKQWEEYSVLAW

Show »
Length:620
Mass (Da):71,962
Checksum:i10437F28D20EAB06
GO
Isoform 4 (identifier: Q9ULJ1-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     353-381: Missing.
     632-636: DPETP → KAQHQEVCLKEVQNSLEKSENQNESIKNYLQFLKTSYVTMFE

Show »
Length:644
Mass (Da):74,765
Checksum:iC7F94FF7790D8FF1
GO
Isoform 5 (identifier: Q9ULJ1-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-131: Missing.
     353-381: Missing.
     632-636: DPETP → KAQHQEVCLKEVQNSLEKSENQNESIKNYLQFLKTSYVTMFE

Show »
Length:513
Mass (Da):59,803
Checksum:i056290F9824311AD
GO
Isoform 6 (identifier: Q9ULJ1-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     353-381: Missing.
     454-506: Missing.
     632-636: DPETP → KAQHQEVCLKEVQNSLEKSENQNESIKNYLQFLKTSYVTMFE

Show »
Length:591
Mass (Da):68,639
Checksum:iCEB4025EB317F8FD
GO

Computationally mapped potential isoform sequencesi

There are 7 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9PNP0E9PNP0_HUMAN
Protein BCAP
ODF2L
243Annotation score:
H0YF19H0YF19_HUMAN
Protein BCAP
ODF2L
153Annotation score:
H0YD68H0YD68_HUMAN
Protein BCAP
ODF2L
520Annotation score:
B5ME44B5ME44_HUMAN
Protein BCAP
ODF2L
49Annotation score:
H0YCM1H0YCM1_HUMAN
Protein BCAP
ODF2L
54Annotation score:
E9PJZ1E9PJZ1_HUMAN
Protein BCAP
ODF2L
43Annotation score:
E9PMV9E9PMV9_HUMAN
Protein BCAP
ODF2L
60Annotation score:

Sequence cautioni

The sequence AAH29420 differs from that shown. Contaminating sequence. Potential poly-A sequence.Curated
The sequence AAH47368 differs from that shown. Reason: Erroneous termination at position 397. Translated as Glu.Curated
The sequence AK308351 differs from that shown. Reason: Frameshift at position 296.Curated
The sequence BAA86543 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti135E → G in AAH47368 (PubMed:15489334).Curated1
Sequence conflicti203L → S in AAH29420 (PubMed:15489334).Curated1
Sequence conflicti339Y → H in BAA86543 (PubMed:10574462).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_036882177R → H. Corresponds to variant dbSNP:rs12032435Ensembl.1
Natural variantiVAR_036883350K → R1 PublicationCorresponds to variant dbSNP:rs17854440Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0409301 – 131Missing in isoform 5. 1 PublicationAdd BLAST131
Alternative sequenceiVSP_029057353 – 381Missing in isoform 3, isoform 4, isoform 5 and isoform 6. 3 PublicationsAdd BLAST29
Alternative sequenceiVSP_029058454 – 506Missing in isoform 2 and isoform 6. 2 PublicationsAdd BLAST53
Alternative sequenceiVSP_029059506Q → QILKQWEEYSVLAW in isoform 3. 1 Publication1
Alternative sequenceiVSP_029060632 – 636DPETP → KAQHQEVCLKEVQNSLEKSE NQNESIKNYLQFLKTSYVTM FE in isoform 2, isoform 4, isoform 5 and isoform 6. 3 Publications5

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB033055 mRNA Translation: BAA86543.1 Different initiation.
AK303209 mRNA Translation: BAG64299.1
AK308351 mRNA No translation available.
CR591511 mRNA No translation available.
AC119749 Genomic DNA No translation available.
AL136382 Genomic DNA No translation available.
CH471097 Genomic DNA Translation: EAW73190.1
CH471097 Genomic DNA Translation: EAW73192.1
BC029420 mRNA Translation: AAH29420.1 Sequence problems.
BC047368 mRNA Translation: AAH47368.1 Sequence problems.
BC091490 mRNA Translation: AAH91490.1
CCDSiCCDS30763.2 [Q9ULJ1-3]
CCDS41354.2 [Q9ULJ1-1]
CCDS53339.1 [Q9ULJ1-6]
RefSeqiNP_001007023.2, NM_001007022.2 [Q9ULJ1-1]
NP_001171694.1, NM_001184765.1 [Q9ULJ1-2]
NP_001171695.1, NM_001184766.1 [Q9ULJ1-6]
NP_065780.2, NM_020729.2 [Q9ULJ1-3]
XP_005271111.1, XM_005271054.3 [Q9ULJ1-4]
XP_011540121.1, XM_011541819.2 [Q9ULJ1-1]
XP_016857366.1, XM_017001877.1 [Q9ULJ1-4]
UniGeneiHs.149360

Genome annotation databases

EnsembliENST00000294678; ENSP00000294678; ENSG00000122417 [Q9ULJ1-3]
ENST00000317336; ENSP00000320165; ENSG00000122417 [Q9ULJ1-1]
ENST00000359242; ENSP00000359600; ENSG00000122417 [Q9ULJ1-1]
ENST00000370566; ENSP00000359597; ENSG00000122417 [Q9ULJ1-6]
GeneIDi57489
KEGGihsa:57489
UCSCiuc001dll.3 human [Q9ULJ1-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB033055 mRNA Translation: BAA86543.1 Different initiation.
AK303209 mRNA Translation: BAG64299.1
AK308351 mRNA No translation available.
CR591511 mRNA No translation available.
AC119749 Genomic DNA No translation available.
AL136382 Genomic DNA No translation available.
CH471097 Genomic DNA Translation: EAW73190.1
CH471097 Genomic DNA Translation: EAW73192.1
BC029420 mRNA Translation: AAH29420.1 Sequence problems.
BC047368 mRNA Translation: AAH47368.1 Sequence problems.
BC091490 mRNA Translation: AAH91490.1
CCDSiCCDS30763.2 [Q9ULJ1-3]
CCDS41354.2 [Q9ULJ1-1]
CCDS53339.1 [Q9ULJ1-6]
RefSeqiNP_001007023.2, NM_001007022.2 [Q9ULJ1-1]
NP_001171694.1, NM_001184765.1 [Q9ULJ1-2]
NP_001171695.1, NM_001184766.1 [Q9ULJ1-6]
NP_065780.2, NM_020729.2 [Q9ULJ1-3]
XP_005271111.1, XM_005271054.3 [Q9ULJ1-4]
XP_011540121.1, XM_011541819.2 [Q9ULJ1-1]
XP_016857366.1, XM_017001877.1 [Q9ULJ1-4]
UniGeneiHs.149360

3D structure databases

ProteinModelPortaliQ9ULJ1
SMRiQ9ULJ1
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi121557, 18 interactors
IntActiQ9ULJ1, 29 interactors

PTM databases

iPTMnetiQ9ULJ1
PhosphoSitePlusiQ9ULJ1

Polymorphism and mutation databases

BioMutaiODF2L
DMDMi160013283

Proteomic databases

EPDiQ9ULJ1
PaxDbiQ9ULJ1
PeptideAtlasiQ9ULJ1
PRIDEiQ9ULJ1
ProteomicsDBi85040
85041 [Q9ULJ1-2]
85042 [Q9ULJ1-3]
85043 [Q9ULJ1-4]
85044 [Q9ULJ1-5]
85045 [Q9ULJ1-6]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000294678; ENSP00000294678; ENSG00000122417 [Q9ULJ1-3]
ENST00000317336; ENSP00000320165; ENSG00000122417 [Q9ULJ1-1]
ENST00000359242; ENSP00000359600; ENSG00000122417 [Q9ULJ1-1]
ENST00000370566; ENSP00000359597; ENSG00000122417 [Q9ULJ1-6]
GeneIDi57489
KEGGihsa:57489
UCSCiuc001dll.3 human [Q9ULJ1-1]

Organism-specific databases

CTDi57489
EuPathDBiHostDB:ENSG00000122417.15
GeneCardsiODF2L
HGNCiHGNC:29225 ODF2L
HPAiHPA028020
HPA028095
HPA028333
neXtProtiNX_Q9ULJ1
OpenTargetsiENSG00000122417
PharmGKBiPA142671232
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IJHH Eukaryota
ENOG410YEYY LUCA
GeneTreeiENSGT00530000063497
HOVERGENiHBG054948
InParanoidiQ9ULJ1
OMAiGKNSCEE
OrthoDBiEOG091G13KV
PhylomeDBiQ9ULJ1
TreeFamiTF328605

Miscellaneous databases

GenomeRNAii57489
PROiPR:Q9ULJ1

Gene expression databases

BgeeiENSG00000122417 Expressed in 180 organ(s), highest expression level in intestine
CleanExiHS_ODF2L
ExpressionAtlasiQ9ULJ1 baseline and differential
GenevisibleiQ9ULJ1 HS

Family and domain databases

InterProiView protein in InterPro
IPR026102 BCAP
IPR026099 Odf2-rel
PANTHERiPTHR23162 PTHR23162, 1 hit
PTHR23162:SF7 PTHR23162:SF7, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiODF2L_HUMAN
AccessioniPrimary (citable) accession number: Q9ULJ1
Secondary accession number(s): A8MU56
, B4E037, Q05C40, Q5BJG5, Q5TBX3, Q5TBX4, Q86X31
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 23, 2007
Last sequence update: October 23, 2007
Last modified: October 10, 2018
This is version 115 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. SIMILARITY comments
    Index of protein domains and families
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again