Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 162 (31 Jul 2019)
Sequence version 3 (27 Jun 2003)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Myocardin-related transcription factor B

Gene

MRTFB

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Acts as a transcriptional coactivator of serum response factor (SRF). Required for skeletal myogenic differentiation.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActivator, Developmental protein
Biological processDifferentiation, Myogenesis, Transcription, Transcription regulation

Enzyme and pathway databases

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q9ULH7

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Myocardin-related transcription factor BCurated
Short name:
MRTF-BCurated
Alternative name(s):
MKL/myocardin-like protein 2
Megakaryoblastic leukemia 21 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:MRTFBImported
Synonyms:KIAA1243, MKL21 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 16

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:29819 MRTFB

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
609463 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9ULH7

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

A chromosomal aberration involving C11orf95 is found in 3 chondroid lipomas. Translocation t(11;16)(q13;p13) with C11orf95 produces a C11orf95-MRTFB fusion protein (PubMed:20607705).1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections (‘Function’, ‘PTM / Processing’, ‘Pathology and Biotech’) according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei394Breakpoint for translocation to form C11orf95-MRTFB fusion protein1

Organism-specific databases

DisGeNET

More...
DisGeNETi
57496

Open Targets

More...
OpenTargetsi
ENSG00000186260

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134981329

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
MKL2

Domain mapping of disease mutations (DMDM)

More...
DMDMi
32363203

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001266281 – 1088Myocardin-related transcription factor BAdd BLAST1088

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei66PhosphoserineCombined sources1
Modified residuei367PhosphothreonineCombined sources1
Modified residuei370PhosphothreonineCombined sources1
Modified residuei541PhosphoserineCombined sources1
Modified residuei543PhosphoserineCombined sources1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki628Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1)Combined sources
Modified residuei921PhosphoserineCombined sources1
Isoform 4 (identifier: Q9ULH7-4)
Modified residuei22PhosphoserineCombined sources1
Isoform 5 (identifier: Q9ULH7-5)
Modified residuei22PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

O-glycosylated.By similarity

Keywords - PTMi

Glycoprotein, Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9ULH7

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9ULH7

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9ULH7

PeptideAtlas

More...
PeptideAtlasi
Q9ULH7

PRoteomics IDEntifications database

More...
PRIDEi
Q9ULH7

ProteomicsDB human proteome resource

More...
ProteomicsDBi
4158
85028 [Q9ULH7-1]
85029 [Q9ULH7-2]
85030 [Q9ULH7-3]
85031 [Q9ULH7-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9ULH7

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9ULH7

Miscellaneous databases

CutDB - Proteolytic event database

More...
PMAP-CutDBi
Q9ULH7

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000186260 Expressed in 230 organ(s), highest expression level in forebrain

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9ULH7 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9ULH7 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA011286

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with MRTFA and SRF.

1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
SRFP118313EBI-493007,EBI-493034

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
121563, 16 interactors

The Eukaryotic Linear Motif resource for Functional Sites in Proteins

More...
ELMi
Q9ULH7

Protein interaction database and analysis system

More...
IntActi
Q9ULH7, 10 interactors

Molecular INTeraction database

More...
MINTi
Q9ULH7

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000339086

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9ULH7

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati40 – 65RPEL 1Add BLAST26
Repeati84 – 109RPEL 2Add BLAST26
Repeati128 – 153RPEL 3Add BLAST26
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini389 – 423SAPPROSITE-ProRule annotationAdd BLAST35

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni563 – 591Required for interaction with itself and with MRTFAAdd BLAST29

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili545 – 601Sequence analysisAdd BLAST57

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi671 – 787Gln-richAdd BLAST117

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The N-terminal region is required for nuclear localization and the C-terminal region mediates transcriptional activity.By similarity

Keywords - Domaini

Coiled coil, Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IFJX Eukaryota
ENOG41101AM LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00950000182979

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000038001

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9ULH7

KEGG Orthology (KO)

More...
KOi
K22525

Identification of Orthologs from Complete Genome Data

More...
OMAi
FAASTPC

Database of Orthologous Groups

More...
OrthoDBi
190145at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9ULH7

TreeFam database of animal gene trees

More...
TreeFami
TF326024

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.720.30, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR004018 RPEL_repeat
IPR003034 SAP_dom
IPR036361 SAP_dom_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF02755 RPEL, 2 hits
PF02037 SAP, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00707 RPEL, 3 hits
SM00513 SAP, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF68906 SSF68906, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51073 RPEL, 3 hits
PS50800 SAP, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9ULH7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MIDSSKKQQQ GFPEILTAGD FEPLKEKECL EGSNQKSLKE VLQLRLQQRR
60 70 80 90 100
TREQLVDQGI MPPLKSPAAF HEQIKSLERA RTENFLKHKI RSRPDRSELV
110 120 130 140 150
RMHILEETFA EPSLQATQMK LKRARLADDL NEKIAQRPGP MELVEKNILP
160 170 180 190 200
VDSSVKEAII GVGKEDYPHT QGDFSFDEDS SDALSPDQPA SQESQGSAAS
210 220 230 240 250
PSEPKVSESP SPVTTNTPAQ FASVSPTVPE FLKTPPTADQ PPPRPAAPVL
260 270 280 290 300
PTNTVSSAKP GPALVKQSHP KNPNDKHRSK KCKDPKPRVK KLKYHQYIPP
310 320 330 340 350
DQKGEKNEPQ MDSNYARLLQ QQQLFLQLQI LSQQKQHYNY QTILPAPFKP
360 370 380 390 400
LNDKNSNSGN SALNNATPNT PRQNTSTPVR KPGPLPSSLD DLKVSELKTE
410 420 430 440 450
LKLRGLPVSG TKPDLIERLK PYQEVNSSGL AAGGIVAVSS SAIVTSNPEV
460 470 480 490 500
TVALPVTTLH NTVTSSVSTL KAELPPTGTS NATRVENVHS PLPISPSPSE
510 520 530 540 550
QSSLSTDDTN MADTFTEIMT MMSPSQFLSS SPLRMTNNED SLSPTSSTLS
560 570 580 590 600
NLELDAAEKD RKLQEKEKQI EELKRKLEQE QKLVEVLKMQ LEVEKRGQQQ
610 620 630 640 650
RPLEAQPSAP GHSVKSDQKH GSLGSSIKDE ASLPDCSSSR QPIPVASHAV
660 670 680 690 700
GQPVSTGGQT LVAKKAVVIK QEVPVGQAEQ QSVVSQFYVS SQGQPPPAVV
710 720 730 740 750
AQPQALLTTQ TAQLLLPVSI QGSSVTSVQL PVGSLKLQTS PQAGMQTQPQ
760 770 780 790 800
IATAAQIPTA ALASGLAPTV PQTQDTFPQH VLSQPQQVRK VFTNSASSNT
810 820 830 840 850
VLPYQRHPAP AVQQPFINKA SNSVLQSRNA PLPSLQNGPN TPNKPSSPPP
860 870 880 890 900
PQQFVVQHSL FGSPVAKTKD PPRYEEAIKQ TRSTQAPLPE ISNAHSQQMD
910 920 930 940 950
DLFDILIKSG EISLPIKEEP SPISKMRPVT ASITTMPVNT VVSRPPPQVQ
960 970 980 990 1000
MAPPVSLEPM GSLSASLENQ LEAFLDGTLP SANEIPPLQS SSEDREPFSL
1010 1020 1030 1040 1050
IEDLQNDLLS HSGMLDHSHS PMETSETQFA AGTPCLSLDL SDSNLDNMEW
1060 1070 1080
LDITMPNSSS GLTPLSTTAP SMFSADFLDP QDLPLPWD
Length:1,088
Mass (Da):118,127
Last modified:June 27, 2003 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i0CA4A52A115C0C83
GO
Isoform 2 (identifier: Q9ULH7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-41: MIDSSKKQQQGFPEILTAGDFEPLKEKECLEGSNQKSLKEV → M
     350-418: PLNDKNSNSG...SGTKPDLIER → AYHTVSEVHM...VSSIIPGINS
     419-1088: Missing.

Note: No experimental confirmation available.
Show »
Length:378
Mass (Da):42,496
Checksum:i265D363A09230333
GO
Isoform 3 (identifier: Q9ULH7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     350-461: PLNDKNSNSG...VALPVTTLHN → YGGAHAILNA...VSSIIPGINS
     462-1088: Missing.

Note: No experimental confirmation available.
Show »
Length:461
Mass (Da):51,902
Checksum:i94540BFA3F4213AB
GO
Isoform 4 (identifier: Q9ULH7-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-40: MIDSSKKQQQ...EGSNQKSLKE → MDHTGAIDTE...NLPPLNERKN
     689-738: Missing.

Show »
Length:1,049
Mass (Da):114,119
Checksum:iE8DC053F48F8AA4F
GO
Isoform 5 (identifier: Q9ULH7-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-40: MIDSSKKQQQ...EGSNQKSLKE → MDHTGAIDTE...NLPPLNERKN

Show »
Length:1,099
Mass (Da):119,165
Checksum:i36FB8F1653F10868
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
I3L2S3I3L2S3_HUMAN
Phosphatase and actin regulator
MRTFB MKL2, hCG_1982625
369Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
I3L3Z7I3L3Z7_HUMAN
Myocardin-related transcription fac...
MRTFB
52Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
I3L2A0I3L2A0_HUMAN
Myocardin-related transcription fac...
MRTFB
191Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
I3L0U1I3L0U1_HUMAN
Myocardin-related transcription fac...
MRTFB
70Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti266K → R in BAC04200 (PubMed:14702039).Curated1
Sequence conflicti350P → A in AAQ82435 (PubMed:14565952).Curated1
Sequence conflicti592E → G in CAH18657 (PubMed:17974005).Curated1
Sequence conflicti598Q → R in AAQ82435 (PubMed:14565952).Curated1
Sequence conflicti629D → G in AAQ82435 (PubMed:14565952).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_064732390D → G Found in a renal cell carcinoma sample; somatic mutation. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0076531 – 41MIDSS…SLKEV → M in isoform 2. 1 PublicationAdd BLAST41
Alternative sequenceiVSP_0133551 – 40MIDSS…KSLKE → MDHTGAIDTEDEVGPLAHLA PSPQSEAVAHEFQELSLQSS QNLPPLNERKN in isoform 4 and isoform 5. 3 PublicationsAdd BLAST40
Alternative sequenceiVSP_007656350 – 461PLNDK…TTLHN → YGGAHAILNAGFSVVFMRNY KLPKVECCHLFVLSNDFHFF VIRAYHTVSEVHMVRVACIP FQFLSSKIGSEFLQVRNAFS QLFIQICLLLEHQNSTRCSE KSVSSIIPGINS in isoform 3. 1 PublicationAdd BLAST112
Alternative sequenceiVSP_007654350 – 418PLNDK…DLIER → AYHTVSEVHMVRVACIPFQF LSSKIGSEFLQVRNAFSQLF IQICLLLEHQNSTRCSEKSV SSIIPGINS in isoform 2. 1 PublicationAdd BLAST69
Alternative sequenceiVSP_007655419 – 1088Missing in isoform 2. 1 PublicationAdd BLAST670
Alternative sequenceiVSP_007657462 – 1088Missing in isoform 3. 1 PublicationAdd BLAST627
Alternative sequenceiVSP_013356689 – 738Missing in isoform 4. 1 PublicationAdd BLAST50

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY374297 mRNA Translation: AAQ82435.1
AK093577 mRNA Translation: BAC04200.1
AK294765 mRNA Translation: BAG57899.1
AC012626 Genomic DNA No translation available.
AC040173 Genomic DNA No translation available.
AC130650 Genomic DNA No translation available.
CH471112 Genomic DNA Translation: EAW85112.1
BC047761 mRNA Translation: AAH47761.1
BC136260 mRNA Translation: AAI36261.1
BC171750 mRNA Translation: AAI71750.1
AB033069 mRNA Translation: BAA86557.2
CR749797 mRNA Translation: CAH18657.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS32391.1 [Q9ULH7-4]
CCDS76823.1 [Q9ULH7-5]

NCBI Reference Sequences

More...
RefSeqi
NP_001295071.1, NM_001308142.1 [Q9ULH7-5]
NP_054767.3, NM_014048.4 [Q9ULH7-4]
XP_005255509.1, XM_005255452.3 [Q9ULH7-5]
XP_005255510.1, XM_005255453.4 [Q9ULH7-5]
XP_005255512.1, XM_005255455.3
XP_006720971.1, XM_006720908.3 [Q9ULH7-5]
XP_006720972.1, XM_006720909.3 [Q9ULH7-5]
XP_006720977.1, XM_006720914.2 [Q9ULH7-4]
XP_011520870.1, XM_011522568.2 [Q9ULH7-5]
XP_016878990.1, XM_017023501.1 [Q9ULH7-5]
XP_016878991.1, XM_017023502.1 [Q9ULH7-5]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000318282; ENSP00000339086; ENSG00000186260 [Q9ULH7-4]
ENST00000571589; ENSP00000459626; ENSG00000186260 [Q9ULH7-5]
ENST00000573051; ENSP00000460589; ENSG00000186260 [Q9ULH7-2]
ENST00000574045; ENSP00000459205; ENSG00000186260 [Q9ULH7-4]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
57496

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:57496

UCSC genome browser

More...
UCSCi
uc002dcg.4 human [Q9ULH7-1]

Keywords - Coding sequence diversityi

Alternative splicing, Chromosomal rearrangement, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY374297 mRNA Translation: AAQ82435.1
AK093577 mRNA Translation: BAC04200.1
AK294765 mRNA Translation: BAG57899.1
AC012626 Genomic DNA No translation available.
AC040173 Genomic DNA No translation available.
AC130650 Genomic DNA No translation available.
CH471112 Genomic DNA Translation: EAW85112.1
BC047761 mRNA Translation: AAH47761.1
BC136260 mRNA Translation: AAI36261.1
BC171750 mRNA Translation: AAI71750.1
AB033069 mRNA Translation: BAA86557.2
CR749797 mRNA Translation: CAH18657.1
CCDSiCCDS32391.1 [Q9ULH7-4]
CCDS76823.1 [Q9ULH7-5]
RefSeqiNP_001295071.1, NM_001308142.1 [Q9ULH7-5]
NP_054767.3, NM_014048.4 [Q9ULH7-4]
XP_005255509.1, XM_005255452.3 [Q9ULH7-5]
XP_005255510.1, XM_005255453.4 [Q9ULH7-5]
XP_005255512.1, XM_005255455.3
XP_006720971.1, XM_006720908.3 [Q9ULH7-5]
XP_006720972.1, XM_006720909.3 [Q9ULH7-5]
XP_006720977.1, XM_006720914.2 [Q9ULH7-4]
XP_011520870.1, XM_011522568.2 [Q9ULH7-5]
XP_016878990.1, XM_017023501.1 [Q9ULH7-5]
XP_016878991.1, XM_017023502.1 [Q9ULH7-5]

3D structure databases

SMRiQ9ULH7
ModBaseiSearch...

Protein-protein interaction databases

BioGridi121563, 16 interactors
ELMiQ9ULH7
IntActiQ9ULH7, 10 interactors
MINTiQ9ULH7
STRINGi9606.ENSP00000339086

PTM databases

iPTMnetiQ9ULH7
PhosphoSitePlusiQ9ULH7

Polymorphism and mutation databases

BioMutaiMKL2
DMDMi32363203

Proteomic databases

EPDiQ9ULH7
jPOSTiQ9ULH7
PaxDbiQ9ULH7
PeptideAtlasiQ9ULH7
PRIDEiQ9ULH7
ProteomicsDBi4158
85028 [Q9ULH7-1]
85029 [Q9ULH7-2]
85030 [Q9ULH7-3]
85031 [Q9ULH7-4]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000318282; ENSP00000339086; ENSG00000186260 [Q9ULH7-4]
ENST00000571589; ENSP00000459626; ENSG00000186260 [Q9ULH7-5]
ENST00000573051; ENSP00000460589; ENSG00000186260 [Q9ULH7-2]
ENST00000574045; ENSP00000459205; ENSG00000186260 [Q9ULH7-4]
GeneIDi57496
KEGGihsa:57496
UCSCiuc002dcg.4 human [Q9ULH7-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
57496
DisGeNETi57496

GeneCards: human genes, protein and diseases

More...
GeneCardsi
MKL2
HGNCiHGNC:29819 MRTFB
HPAiHPA011286
MIMi609463 gene
neXtProtiNX_Q9ULH7
OpenTargetsiENSG00000186260
PharmGKBiPA134981329

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IFJX Eukaryota
ENOG41101AM LUCA
GeneTreeiENSGT00950000182979
HOGENOMiHOG000038001
InParanoidiQ9ULH7
KOiK22525
OMAiFAASTPC
OrthoDBi190145at2759
PhylomeDBiQ9ULH7
TreeFamiTF326024

Enzyme and pathway databases

SIGNORiQ9ULH7

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
MKL2 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
MKL2

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
57496
PMAP-CutDBiQ9ULH7

Protein Ontology

More...
PROi
PR:Q9ULH7

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000186260 Expressed in 230 organ(s), highest expression level in forebrain
ExpressionAtlasiQ9ULH7 baseline and differential
GenevisibleiQ9ULH7 HS

Family and domain databases

Gene3Di1.10.720.30, 1 hit
InterProiView protein in InterPro
IPR004018 RPEL_repeat
IPR003034 SAP_dom
IPR036361 SAP_dom_sf
PfamiView protein in Pfam
PF02755 RPEL, 2 hits
PF02037 SAP, 1 hit
SMARTiView protein in SMART
SM00707 RPEL, 3 hits
SM00513 SAP, 1 hit
SUPFAMiSSF68906 SSF68906, 1 hit
PROSITEiView protein in PROSITE
PS51073 RPEL, 3 hits
PS50800 SAP, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMRTFB_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9ULH7
Secondary accession number(s): A6ND53
, B4DGT8, Q68CT1, Q6UB16, Q86WW2, Q8N226
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 27, 2003
Last sequence update: June 27, 2003
Last modified: July 31, 2019
This is version 162 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again