Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Microtubule-associated tumor suppressor 1

Gene

MTUS1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Cooperates with AGTR2 to inhibit ERK2 activation and cell proliferation. May be required for AGTR2 cell surface expression. Together with PTPN6, induces UBE2V2 expression upon angiotensin-II stimulation. Isoform 1 inhibits breast cancer cell proliferation, delays the progression of mitosis by prolonging metaphase and reduces tumor growth.2 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • microtubule binding Source: GO_Central

GO - Biological processi

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Microtubule-associated tumor suppressor 1
Alternative name(s):
AT2 receptor-binding protein
Angiotensin-II type 2 receptor-interacting protein
Mitochondrial tumor suppressor 1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:MTUS1
Synonyms:ATBP, ATIP, GK1, KIAA1288, MTSG1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 8

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000129422.14

Human Gene Nomenclature Database

More...
HGNCi
HGNC:29789 MTUS1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
609589 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9ULD2

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cell membrane, Cytoplasm, Cytoskeleton, Golgi apparatus, Membrane, Microtubule, Mitochondrion, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Hepatocellular carcinoma (HCC)1 Publication
The gene represented in this entry may be involved in disease pathogenesis.
Disease descriptionA primary malignant neoplasm of epithelial liver cells. The major risk factors for HCC are chronic hepatitis B virus (HBV) infection, chronic hepatitis C virus (HCV) infection, prolonged dietary aflatoxin exposure, alcoholic cirrhosis, and cirrhosis due to other causes.
See also OMIM:114550
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_03517375Q → K in HCC. 1 PublicationCorresponds to variant dbSNP:rs61733703Ensembl.1
Natural variantiVAR_035178563A → S in HCC. 1 Publication1
Natural variantiVAR_035180873N → H in HCC. 1 PublicationCorresponds to variant dbSNP:rs187103704Ensembl.1
Natural variantiVAR_0351841201Q → R in HCC. 1 PublicationCorresponds to variant dbSNP:rs567116808Ensembl.1

Keywords - Diseasei

Disease mutation, Tumor suppressor

Organism-specific databases

DisGeNET

More...
DisGeNETi
57509

MalaCards human disease database

More...
MalaCardsi
MTUS1
MIMi114550 phenotype

Open Targets

More...
OpenTargetsi
ENSG00000129422

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134968054

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
MTUS1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
158706128

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003051971 – 1270Microtubule-associated tumor suppressor 1Add BLAST1270

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei186PhosphothreonineCombined sources1
Modified residuei381PhosphoserineBy similarity1
Modified residuei399PhosphoserineCombined sources1
Modified residuei443PhosphoserineCombined sources1
Modified residuei629PhosphoserineCombined sources1
Modified residuei1203PhosphoserineBy similarity1
Modified residuei1224PhosphoserineCombined sources1
Modified residuei1245PhosphoserineCombined sources1
Modified residuei1255PhosphoserineBy similarity1
Modified residuei1259PhosphoserineBy similarity1
Modified residuei1261PhosphoserineBy similarity1
Modified residuei1264PhosphoserineCombined sources1
Modified residuei1268PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9ULD2

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9ULD2

PeptideAtlas

More...
PeptideAtlasi
Q9ULD2

PRoteomics IDEntifications database

More...
PRIDEi
Q9ULD2

ProteomicsDB human proteome resource

More...
ProteomicsDBi
84989
84990 [Q9ULD2-2]
84991 [Q9ULD2-3]
84992 [Q9ULD2-4]
84993 [Q9ULD2-5]
84994 [Q9ULD2-6]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9ULD2

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9ULD2

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Ubiquitously expressed (at protein level). Highly expressed in brain. Down-regulated in ovarian carcinoma, pancreas carcinoma, colon carcinoma and head and neck squamous cell carcinoma (HNSCC). Isoform 1 is the major isoform in most peripheral tissues. Isoform 2 is abundant in most peripheral tissues. Isoform 3 is the major isoform in brain, female reproductive tissues, thyroid and heart. Within brain it is highly expressed in corpus callosum and pons. Isoform 6 is brain-specific, it is the major isoform in cerebellum and fetal brain.7 Publications

<p>This subsection of the ‘Expression’ section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Isoform 1 is down-regulated in invasive breast carcinomas (at protein level).1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000129422 Expressed in 241 organ(s), highest expression level in corpus callosum

CleanEx database of gene expression profiles

More...
CleanExi
HS_MTUS1

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9ULD2 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9ULD2 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA067903
HPA069795

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer. Interacts with AGTR2. Interacts with PTPN6 (By similarity). Isoform 1 associates with microtubules.By similarity1 Publication

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
121573, 26 interactors

Protein interaction database and analysis system

More...
IntActi
Q9ULD2, 25 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000262102

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q9ULD2

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9ULD2

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili940 – 1231Sequence analysisAdd BLAST292

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the MTUS1 family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IEXM Eukaryota
ENOG41118DX LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000156412

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000013016

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG108158

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9ULD2

Identification of Orthologs from Complete Genome Data

More...
OMAi
NASHKVP

Database of Orthologous Groups

More...
OrthoDBi
EOG091G0DE4

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9ULD2

TreeFam database of animal gene trees

More...
TreeFami
TF333416

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR029786 MTUS1

The PANTHER Classification System

More...
PANTHERi
PTHR24200:SF7 PTHR24200:SF7, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (7+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 7 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 7 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9ULD2-1) [UniParc]FASTAAdd to basket
Also known as: ATIP3a

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MTDDNSDDKI EDELQTFFTS DKDGNTHAYN PKSPPTQNSS ASSVNWNSAN
60 70 80 90 100
PDDMVVDYET DPAVVTGENI SLSLQGVEVF GHEKSSSDFI SKQVLDMHKD
110 120 130 140 150
SICQCPALVG TEKPKYLQHS CHSLEAVEGQ SVEPSLPFVW KPNDNLNCAG
160 170 180 190 200
YCDALELNQT FDMTVDKVNC TFISHHAIGK SQSFHTAGSL PPTGRRSGST
210 220 230 240 250
SSLSYSTWTS SHSDKTHARE TTYDRESFEN PQVTPSEAQD MTYTAFSDVV
260 270 280 290 300
MQSEVFVSDI GNQCACSSGK VTSEYTDGSQ QRLVGEKETQ ALTPVSDGME
310 320 330 340 350
VPNDSALQEF FCLSHDESNS EPHSQSSYRH KEMGQNLRET VSYCLIDDEC
360 370 380 390 400
PLMVPAFDKS EAQVLNPEHK VTETEDTQMV SKGKDLGTQN HTSELILSSP
410 420 430 440 450
PGQKVGSSFG LTWDANDMVI STDKTMCMST PVLEPTKVTF SVSPIEATEK
460 470 480 490 500
CKKVEKGNRG LKNIPDSKEA PVNLCKPSLG KSTIKTNTPI GCKVRKTEII
510 520 530 540 550
SYPRPNFKNV KAKVMSRAVL QPKDAALSKV TPRPQQTSAS SPSSVNSRQQ
560 570 580 590 600
TVLSRTPRSD LNADKKAEIL INKTHKQQFN KLITSQAVHV TTHSKNASHR
610 620 630 640 650
VPRTTSAVKS NQEDVDKASS SNSACETGSV SALFQKIKGI LPVKMESAEC
660 670 680 690 700
LEMTYVPNID RISPEKKGEK ENGTSMEKQE LKQEIMNETF EYGSLFLGSA
710 720 730 740 750
SKTTTTSGRN ISKPDSCGLR QIAAPKAKVG PPVSCLRRNS DNRNPSADRA
760 770 780 790 800
VSPQRIRRVS SSGKPTSLKT AQSSWVNLPR PLPKSKASLK SPALRRTGST
810 820 830 840 850
PSIASTHSEL STYSNNSGNA AVIKYEEKPP KPAFQNGSSG SFYLKPLVSR
860 870 880 890 900
AHVHLMKTPP KGPSRKNLFT ALNAVEKSRQ KNPRSLCIQP QTAPDALPPE
910 920 930 940 950
KTLELTQYKT KCENQSGFIL QLKQLLACGN TKFEALTVVI QHLLSEREEA
960 970 980 990 1000
LKQHKTLSQE LVNLRGELVT ASTTCEKLEK ARNELQTVYE AFVQQHQAEK
1010 1020 1030 1040 1050
TERENRLKEF YTREYEKLRD TYIEEAEKYK MQLQEQFDNL NAAHETSKLE
1060 1070 1080 1090 1100
IEASHSEKLE LLKKAYEASL SEIKKGHEIE KKSLEDLLSE KQESLEKQIN
1110 1120 1130 1140 1150
DLKSENDALN EKLKSEEQKR RAREKANLKN PQIMYLEQEL ESLKAVLEIK
1160 1170 1180 1190 1200
NEKLHQQDIK LMKMEKLVDN NTALVDKLKR FQQENEELKA RMDKHMAISR
1210 1220 1230 1240 1250
QLSTEQAVLQ ESLEKESKVN KRLSMENEEL LWKLHNGDLC SPKRSPTSSA
1260 1270
IPLQSPRNSG SFPSPSISPR
Length:1,270
Mass (Da):141,397
Last modified:October 2, 2007 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i2EAE962F627BFFE3
GO
Isoform 2 (identifier: Q9ULD2-2) [UniParc]FASTAAdd to basket
Also known as: ATIP3b

The sequence of this isoform differs from the canonical sequence as follows:
     763-817: GKPTSLKTAQSSWVNLPRPLPKSKASLKSPALRRTGSTPSIASTHSELSTYSNNS → A

Show »
Length:1,216
Mass (Da):135,661
Checksum:iECC10DC1CA22BF72
GO
Isoform 3 (identifier: Q9ULD2-3) [UniParc]FASTAAdd to basket
Also known as: ATIP1

The sequence of this isoform differs from the canonical sequence as follows:
     1-834: Missing.
     835-874: QNGSSGSFYL...RKNLFTALNA → MLLSPKFSLS...FRRSTVVFHT

Show »
Length:436
Mass (Da):50,544
Checksum:i196002F8C8D9A6DD
GO
Isoform 4 (identifier: Q9ULD2-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-928: Missing.
     929-946: GNTKFEALTVVIQHLLSE → MGCPSSKLCLYSPCAATR

Show »
Length:342
Mass (Da):39,775
Checksum:i20C0995FFE927E24
GO
Isoform 5 (identifier: Q9ULD2-5) [UniParc]FASTAAdd to basket
Also known as: ATIP2

The sequence of this isoform differs from the canonical sequence as follows:
     763-770: GKPTSLKT → VLPKAAFS
     771-1270: Missing.

Note: Expressed at very low levels in most tissues.
Show »
Length:770
Mass (Da):84,252
Checksum:i46E8EA82686165D8
GO
Isoform 6 (identifier: Q9ULD2-6) [UniParc]FASTAAdd to basket
Also known as: ATIP4

The sequence of this isoform differs from the canonical sequence as follows:
     1-753: Missing.
     754-817: QRIRRVSSSG...SELSTYSNNS → MTVPGGFRSC...LLATFTGKKT

Show »
Length:517
Mass (Da):58,988
Checksum:i43755CC4B064F012
GO
Isoform 7 (identifier: Q9ULD2-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-855: Missing.

Note: No experimental confirmation available.
Show »
Length:415
Mass (Da):48,050
Checksum:i91955F97EA18D77D
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0U1RQI2A0A0U1RQI2_HUMAN
Microtubule-associated tumor suppre...
MTUS1
41Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YC63H0YC63_HUMAN
Microtubule-associated tumor suppre...
MTUS1
505Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH07328 differs from that shown. Contaminating sequence. Potential poly-A sequence.Curated
The sequence AAH33842 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAB14894 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti266C → G in CAB50791 (PubMed:17974005).Curated1
Sequence conflicti918F → L in BAG37243 (PubMed:14702039).Curated1
Sequence conflicti999E → G in CAH56128 (PubMed:17974005).Curated1
Sequence conflicti1149I → T in BAB14894 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_03517375Q → K in HCC. 1 PublicationCorresponds to variant dbSNP:rs61733703Ensembl.1
Natural variantiVAR_035174148C → R5 PublicationsCorresponds to variant dbSNP:rs3739407Ensembl.1
Natural variantiVAR_035175186T → S in HNSCC cell lines. 1 PublicationCorresponds to variant dbSNP:rs141609607Ensembl.1
Natural variantiVAR_035176425T → M1 PublicationCorresponds to variant dbSNP:rs61733694Ensembl.1
Natural variantiVAR_035177453K → T2 PublicationsCorresponds to variant dbSNP:rs17690844Ensembl.1
Natural variantiVAR_035178563A → S in HCC. 1 Publication1
Natural variantiVAR_035179575H → R2 PublicationsCorresponds to variant dbSNP:rs209569Ensembl.1
Natural variantiVAR_035180873N → H in HCC. 1 PublicationCorresponds to variant dbSNP:rs187103704Ensembl.1
Natural variantiVAR_035181911K → T1 PublicationCorresponds to variant dbSNP:rs61748836Ensembl.1
Natural variantiVAR_0351821063K → T1 PublicationCorresponds to variant dbSNP:rs17853231Ensembl.1
Natural variantiVAR_0351831105E → Q1 PublicationCorresponds to variant dbSNP:rs61733705Ensembl.1
Natural variantiVAR_0351841201Q → R in HCC. 1 PublicationCorresponds to variant dbSNP:rs567116808Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0282701 – 928Missing in isoform 4. 1 PublicationAdd BLAST928
Alternative sequenceiVSP_0448491 – 855Missing in isoform 7. 1 PublicationAdd BLAST855
Alternative sequenceiVSP_0282711 – 834Missing in isoform 3. 4 PublicationsAdd BLAST834
Alternative sequenceiVSP_0282721 – 753Missing in isoform 6. 1 PublicationAdd BLAST753
Alternative sequenceiVSP_028273754 – 817QRIRR…YSNNS → MTVPGGFRSCTETDISSKIF INSTLTPPAGSERHYDATLL TLLVVGSYSLCIIPLLATFT GKKT in isoform 6. 1 PublicationAdd BLAST64
Alternative sequenceiVSP_028274763 – 817GKPTS…YSNNS → A in isoform 2. 1 PublicationAdd BLAST55
Alternative sequenceiVSP_028275763 – 770GKPTSLKT → VLPKAAFS in isoform 5. 1 Publication8
Alternative sequenceiVSP_028276771 – 1270Missing in isoform 5. 1 PublicationAdd BLAST500
Alternative sequenceiVSP_028277835 – 874QNGSS…TALNA → MLLSPKFSLSTIHIRLTAKG LLRNLRLPSGFRRSTVVFHT in isoform 3. 4 PublicationsAdd BLAST40
Alternative sequenceiVSP_028278929 – 946GNTKF…HLLSE → MGCPSSKLCLYSPCAATR in isoform 4. 1 PublicationAdd BLAST18

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF121259 mRNA Translation: AAG33674.1
AF293357 mRNA Translation: AAL37035.1
AK024357 mRNA Translation: BAB14894.1 Different initiation.
AK125188 mRNA Translation: BAG54161.1
AK289750 mRNA Translation: BAF82439.1
AK294860 mRNA Translation: BAG57964.1
AK314692 mRNA Translation: BAG37243.1
AL096842 mRNA Translation: CAB50791.1
BX648879 mRNA Translation: CAH56128.1
AC027117 Genomic DNA No translation available.
AC124069 Genomic DNA No translation available.
CH471080 Genomic DNA Translation: EAW63804.1
CH471080 Genomic DNA Translation: EAW63805.1
CH471080 Genomic DNA Translation: EAW63810.1
BC007328 mRNA Translation: AAH07328.1 Sequence problems.
BC033842 mRNA Translation: AAH33842.1 Different initiation.
BC136320 mRNA Translation: AAI36321.1
BC142971 mRNA Translation: AAI42972.1
AY363099 mRNA Translation: AAQ24172.1
AB033114 mRNA Translation: BAA86602.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS43716.1 [Q9ULD2-2]
CCDS43717.1 [Q9ULD2-1]
CCDS43718.1 [Q9ULD2-6]
CCDS43719.1 [Q9ULD2-3]
CCDS55204.1 [Q9ULD2-7]
CCDS83254.1 [Q9ULD2-4]

NCBI Reference Sequences

More...
RefSeqi
NP_001001924.1, NM_001001924.2 [Q9ULD2-1]
NP_001001925.1, NM_001001925.2 [Q9ULD2-2]
NP_001001931.1, NM_001001931.2 [Q9ULD2-6]
NP_001159865.1, NM_001166393.1 [Q9ULD2-7]
NP_001317399.1, NM_001330470.1 [Q9ULD2-4]
NP_065800.1, NM_020749.4 [Q9ULD2-3]
XP_005273636.1, XM_005273579.3
XP_005273639.1, XM_005273582.3
XP_016869189.1, XM_017013700.1
XP_016869190.1, XM_017013701.1
XP_016869191.1, XM_017013702.1

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.7946

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000262102; ENSP00000262102; ENSG00000129422 [Q9ULD2-1]
ENST00000297488; ENSP00000297488; ENSG00000129422 [Q9ULD2-3]
ENST00000381861; ENSP00000371285; ENSG00000129422 [Q9ULD2-6]
ENST00000381869; ENSP00000371293; ENSG00000129422 [Q9ULD2-2]
ENST00000519263; ENSP00000430167; ENSG00000129422 [Q9ULD2-2]
ENST00000544260; ENSP00000445738; ENSG00000129422 [Q9ULD2-7]
ENST00000634613; ENSP00000489288; ENSG00000129422 [Q9ULD2-4]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
57509

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:57509

UCSC genome browser

More...
UCSCi
uc003wxs.4 human [Q9ULD2-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF121259 mRNA Translation: AAG33674.1
AF293357 mRNA Translation: AAL37035.1
AK024357 mRNA Translation: BAB14894.1 Different initiation.
AK125188 mRNA Translation: BAG54161.1
AK289750 mRNA Translation: BAF82439.1
AK294860 mRNA Translation: BAG57964.1
AK314692 mRNA Translation: BAG37243.1
AL096842 mRNA Translation: CAB50791.1
BX648879 mRNA Translation: CAH56128.1
AC027117 Genomic DNA No translation available.
AC124069 Genomic DNA No translation available.
CH471080 Genomic DNA Translation: EAW63804.1
CH471080 Genomic DNA Translation: EAW63805.1
CH471080 Genomic DNA Translation: EAW63810.1
BC007328 mRNA Translation: AAH07328.1 Sequence problems.
BC033842 mRNA Translation: AAH33842.1 Different initiation.
BC136320 mRNA Translation: AAI36321.1
BC142971 mRNA Translation: AAI42972.1
AY363099 mRNA Translation: AAQ24172.1
AB033114 mRNA Translation: BAA86602.1
CCDSiCCDS43716.1 [Q9ULD2-2]
CCDS43717.1 [Q9ULD2-1]
CCDS43718.1 [Q9ULD2-6]
CCDS43719.1 [Q9ULD2-3]
CCDS55204.1 [Q9ULD2-7]
CCDS83254.1 [Q9ULD2-4]
RefSeqiNP_001001924.1, NM_001001924.2 [Q9ULD2-1]
NP_001001925.1, NM_001001925.2 [Q9ULD2-2]
NP_001001931.1, NM_001001931.2 [Q9ULD2-6]
NP_001159865.1, NM_001166393.1 [Q9ULD2-7]
NP_001317399.1, NM_001330470.1 [Q9ULD2-4]
NP_065800.1, NM_020749.4 [Q9ULD2-3]
XP_005273636.1, XM_005273579.3
XP_005273639.1, XM_005273582.3
XP_016869189.1, XM_017013700.1
XP_016869190.1, XM_017013701.1
XP_016869191.1, XM_017013702.1
UniGeneiHs.7946

3D structure databases

ProteinModelPortaliQ9ULD2
SMRiQ9ULD2
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi121573, 26 interactors
IntActiQ9ULD2, 25 interactors
STRINGi9606.ENSP00000262102

PTM databases

iPTMnetiQ9ULD2
PhosphoSitePlusiQ9ULD2

Polymorphism and mutation databases

BioMutaiMTUS1
DMDMi158706128

Proteomic databases

EPDiQ9ULD2
PaxDbiQ9ULD2
PeptideAtlasiQ9ULD2
PRIDEiQ9ULD2
ProteomicsDBi84989
84990 [Q9ULD2-2]
84991 [Q9ULD2-3]
84992 [Q9ULD2-4]
84993 [Q9ULD2-5]
84994 [Q9ULD2-6]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000262102; ENSP00000262102; ENSG00000129422 [Q9ULD2-1]
ENST00000297488; ENSP00000297488; ENSG00000129422 [Q9ULD2-3]
ENST00000381861; ENSP00000371285; ENSG00000129422 [Q9ULD2-6]
ENST00000381869; ENSP00000371293; ENSG00000129422 [Q9ULD2-2]
ENST00000519263; ENSP00000430167; ENSG00000129422 [Q9ULD2-2]
ENST00000544260; ENSP00000445738; ENSG00000129422 [Q9ULD2-7]
ENST00000634613; ENSP00000489288; ENSG00000129422 [Q9ULD2-4]
GeneIDi57509
KEGGihsa:57509
UCSCiuc003wxs.4 human [Q9ULD2-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
57509
DisGeNETi57509
EuPathDBiHostDB:ENSG00000129422.14

GeneCards: human genes, protein and diseases

More...
GeneCardsi
MTUS1
HGNCiHGNC:29789 MTUS1
HPAiHPA067903
HPA069795
MalaCardsiMTUS1
MIMi114550 phenotype
609589 gene
neXtProtiNX_Q9ULD2
OpenTargetsiENSG00000129422
PharmGKBiPA134968054

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IEXM Eukaryota
ENOG41118DX LUCA
GeneTreeiENSGT00940000156412
HOGENOMiHOG000013016
HOVERGENiHBG108158
InParanoidiQ9ULD2
OMAiNASHKVP
OrthoDBiEOG091G0DE4
PhylomeDBiQ9ULD2
TreeFamiTF333416

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
MTUS1 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
MTUS1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
57509

Protein Ontology

More...
PROi
PR:Q9ULD2

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000129422 Expressed in 241 organ(s), highest expression level in corpus callosum
CleanExiHS_MTUS1
ExpressionAtlasiQ9ULD2 baseline and differential
GenevisibleiQ9ULD2 HS

Family and domain databases

InterProiView protein in InterPro
IPR029786 MTUS1
PANTHERiPTHR24200:SF7 PTHR24200:SF7, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMTUS1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9ULD2
Secondary accession number(s): A8K135
, B2RBJ6, B3KWJ9, B4DH03, B9EGA1, D3DSP8, Q63HJ6, Q659F4, Q6PK49, Q6URW7, Q8N4M6, Q8WTT9, Q9H7T2
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 2, 2007
Last sequence update: October 2, 2007
Last modified: December 5, 2018
This is version 135 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 8
    Human chromosome 8: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again