Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Microtubule-associated tumor suppressor 1

Gene

MTUS1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Cooperates with AGTR2 to inhibit ERK2 activation and cell proliferation. May be required for AGTR2 cell surface expression. Together with PTPN6, induces UBE2V2 expression upon angiotensin-II stimulation. Isoform 1 inhibits breast cancer cell proliferation, delays the progression of mitosis by prolonging metaphase and reduces tumor growth.2 Publications

GO - Molecular functioni

  • microtubule binding Source: GO_Central

GO - Biological processi

Names & Taxonomyi

Protein namesi
Recommended name:
Microtubule-associated tumor suppressor 1
Alternative name(s):
AT2 receptor-binding protein
Angiotensin-II type 2 receptor-interacting protein
Mitochondrial tumor suppressor 1
Gene namesi
Name:MTUS1
Synonyms:ATBP, ATIP, GK1, KIAA1288, MTSG1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 8

Organism-specific databases

EuPathDBiHostDB:ENSG00000129422.14
HGNCiHGNC:29789 MTUS1
MIMi609589 gene
neXtProtiNX_Q9ULD2

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Cytoskeleton, Golgi apparatus, Membrane, Microtubule, Mitochondrion, Nucleus

Pathology & Biotechi

Involvement in diseasei

Hepatocellular carcinoma (HCC)1 Publication
The gene represented in this entry may be involved in disease pathogenesis.
Disease descriptionA primary malignant neoplasm of epithelial liver cells. The major risk factors for HCC are chronic hepatitis B virus (HBV) infection, chronic hepatitis C virus (HCV) infection, prolonged dietary aflatoxin exposure, alcoholic cirrhosis, and cirrhosis due to other causes.
See also OMIM:114550
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_03517375Q → K in HCC. 1 PublicationCorresponds to variant dbSNP:rs61733703Ensembl.1
Natural variantiVAR_035178563A → S in HCC. 1 Publication1
Natural variantiVAR_035180873N → H in HCC. 1 PublicationCorresponds to variant dbSNP:rs187103704Ensembl.1
Natural variantiVAR_0351841201Q → R in HCC. 1 PublicationCorresponds to variant dbSNP:rs567116808Ensembl.1

Keywords - Diseasei

Disease mutation, Tumor suppressor

Organism-specific databases

DisGeNETi57509
MalaCardsiMTUS1
MIMi114550 phenotype
OpenTargetsiENSG00000129422
PharmGKBiPA134968054

Polymorphism and mutation databases

BioMutaiMTUS1
DMDMi158706128

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003051971 – 1270Microtubule-associated tumor suppressor 1Add BLAST1270

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei186PhosphothreonineCombined sources1
Modified residuei381PhosphoserineBy similarity1
Modified residuei399PhosphoserineCombined sources1
Modified residuei443PhosphoserineCombined sources1
Modified residuei629PhosphoserineCombined sources1
Modified residuei1203PhosphoserineBy similarity1
Modified residuei1224PhosphoserineCombined sources1
Modified residuei1245PhosphoserineCombined sources1
Modified residuei1255PhosphoserineBy similarity1
Modified residuei1259PhosphoserineBy similarity1
Modified residuei1261PhosphoserineBy similarity1
Modified residuei1264PhosphoserineCombined sources1
Modified residuei1268PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ9ULD2
PaxDbiQ9ULD2
PeptideAtlasiQ9ULD2
PRIDEiQ9ULD2
ProteomicsDBi84989
84990 [Q9ULD2-2]
84991 [Q9ULD2-3]
84992 [Q9ULD2-4]
84993 [Q9ULD2-5]
84994 [Q9ULD2-6]

PTM databases

iPTMnetiQ9ULD2
PhosphoSitePlusiQ9ULD2

Expressioni

Tissue specificityi

Ubiquitously expressed (at protein level). Highly expressed in brain. Down-regulated in ovarian carcinoma, pancreas carcinoma, colon carcinoma and head and neck squamous cell carcinoma (HNSCC). Isoform 1 is the major isoform in most peripheral tissues. Isoform 2 is abundant in most peripheral tissues. Isoform 3 is the major isoform in brain, female reproductive tissues, thyroid and heart. Within brain it is highly expressed in corpus callosum and pons. Isoform 6 is brain-specific, it is the major isoform in cerebellum and fetal brain.7 Publications

Inductioni

Isoform 1 is down-regulated in invasive breast carcinomas (at protein level).1 Publication

Gene expression databases

BgeeiENSG00000129422 Expressed in 241 organ(s), highest expression level in corpus callosum
CleanExiHS_MTUS1
ExpressionAtlasiQ9ULD2 baseline and differential
GenevisibleiQ9ULD2 HS

Organism-specific databases

HPAiHPA067903
HPA069795

Interactioni

Subunit structurei

Homodimer. Interacts with AGTR2. Interacts with PTPN6 (By similarity). Isoform 1 associates with microtubules.By similarity1 Publication

GO - Molecular functioni

Protein-protein interaction databases

BioGridi121573, 24 interactors
IntActiQ9ULD2, 25 interactors
STRINGi9606.ENSP00000262102

Structurei

3D structure databases

ProteinModelPortaliQ9ULD2
SMRiQ9ULD2
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili940 – 1231Sequence analysisAdd BLAST292

Sequence similaritiesi

Belongs to the MTUS1 family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiENOG410IEXM Eukaryota
ENOG41118DX LUCA
GeneTreeiENSGT00390000006245
HOGENOMiHOG000013016
HOVERGENiHBG108158
InParanoidiQ9ULD2
OMAiNASHKVP
OrthoDBiEOG091G0DE4
PhylomeDBiQ9ULD2
TreeFamiTF333416

Family and domain databases

InterProiView protein in InterPro
IPR029786 MTUS1
PANTHERiPTHR24200:SF7 PTHR24200:SF7, 1 hit

Sequences (7+)i

Sequence statusi: Complete.

This entry describes 7 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 7 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9ULD2-1) [UniParc]FASTAAdd to basket
Also known as: ATIP3a

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MTDDNSDDKI EDELQTFFTS DKDGNTHAYN PKSPPTQNSS ASSVNWNSAN
60 70 80 90 100
PDDMVVDYET DPAVVTGENI SLSLQGVEVF GHEKSSSDFI SKQVLDMHKD
110 120 130 140 150
SICQCPALVG TEKPKYLQHS CHSLEAVEGQ SVEPSLPFVW KPNDNLNCAG
160 170 180 190 200
YCDALELNQT FDMTVDKVNC TFISHHAIGK SQSFHTAGSL PPTGRRSGST
210 220 230 240 250
SSLSYSTWTS SHSDKTHARE TTYDRESFEN PQVTPSEAQD MTYTAFSDVV
260 270 280 290 300
MQSEVFVSDI GNQCACSSGK VTSEYTDGSQ QRLVGEKETQ ALTPVSDGME
310 320 330 340 350
VPNDSALQEF FCLSHDESNS EPHSQSSYRH KEMGQNLRET VSYCLIDDEC
360 370 380 390 400
PLMVPAFDKS EAQVLNPEHK VTETEDTQMV SKGKDLGTQN HTSELILSSP
410 420 430 440 450
PGQKVGSSFG LTWDANDMVI STDKTMCMST PVLEPTKVTF SVSPIEATEK
460 470 480 490 500
CKKVEKGNRG LKNIPDSKEA PVNLCKPSLG KSTIKTNTPI GCKVRKTEII
510 520 530 540 550
SYPRPNFKNV KAKVMSRAVL QPKDAALSKV TPRPQQTSAS SPSSVNSRQQ
560 570 580 590 600
TVLSRTPRSD LNADKKAEIL INKTHKQQFN KLITSQAVHV TTHSKNASHR
610 620 630 640 650
VPRTTSAVKS NQEDVDKASS SNSACETGSV SALFQKIKGI LPVKMESAEC
660 670 680 690 700
LEMTYVPNID RISPEKKGEK ENGTSMEKQE LKQEIMNETF EYGSLFLGSA
710 720 730 740 750
SKTTTTSGRN ISKPDSCGLR QIAAPKAKVG PPVSCLRRNS DNRNPSADRA
760 770 780 790 800
VSPQRIRRVS SSGKPTSLKT AQSSWVNLPR PLPKSKASLK SPALRRTGST
810 820 830 840 850
PSIASTHSEL STYSNNSGNA AVIKYEEKPP KPAFQNGSSG SFYLKPLVSR
860 870 880 890 900
AHVHLMKTPP KGPSRKNLFT ALNAVEKSRQ KNPRSLCIQP QTAPDALPPE
910 920 930 940 950
KTLELTQYKT KCENQSGFIL QLKQLLACGN TKFEALTVVI QHLLSEREEA
960 970 980 990 1000
LKQHKTLSQE LVNLRGELVT ASTTCEKLEK ARNELQTVYE AFVQQHQAEK
1010 1020 1030 1040 1050
TERENRLKEF YTREYEKLRD TYIEEAEKYK MQLQEQFDNL NAAHETSKLE
1060 1070 1080 1090 1100
IEASHSEKLE LLKKAYEASL SEIKKGHEIE KKSLEDLLSE KQESLEKQIN
1110 1120 1130 1140 1150
DLKSENDALN EKLKSEEQKR RAREKANLKN PQIMYLEQEL ESLKAVLEIK
1160 1170 1180 1190 1200
NEKLHQQDIK LMKMEKLVDN NTALVDKLKR FQQENEELKA RMDKHMAISR
1210 1220 1230 1240 1250
QLSTEQAVLQ ESLEKESKVN KRLSMENEEL LWKLHNGDLC SPKRSPTSSA
1260 1270
IPLQSPRNSG SFPSPSISPR
Length:1,270
Mass (Da):141,397
Last modified:October 2, 2007 - v2
Checksum:i2EAE962F627BFFE3
GO
Isoform 2 (identifier: Q9ULD2-2) [UniParc]FASTAAdd to basket
Also known as: ATIP3b

The sequence of this isoform differs from the canonical sequence as follows:
     763-817: GKPTSLKTAQSSWVNLPRPLPKSKASLKSPALRRTGSTPSIASTHSELSTYSNNS → A

Show »
Length:1,216
Mass (Da):135,661
Checksum:iECC10DC1CA22BF72
GO
Isoform 3 (identifier: Q9ULD2-3) [UniParc]FASTAAdd to basket
Also known as: ATIP1

The sequence of this isoform differs from the canonical sequence as follows:
     1-834: Missing.
     835-874: QNGSSGSFYL...RKNLFTALNA → MLLSPKFSLS...FRRSTVVFHT

Show »
Length:436
Mass (Da):50,544
Checksum:i196002F8C8D9A6DD
GO
Isoform 4 (identifier: Q9ULD2-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-928: Missing.
     929-946: GNTKFEALTVVIQHLLSE → MGCPSSKLCLYSPCAATR

Show »
Length:342
Mass (Da):39,775
Checksum:i20C0995FFE927E24
GO
Isoform 5 (identifier: Q9ULD2-5) [UniParc]FASTAAdd to basket
Also known as: ATIP2

The sequence of this isoform differs from the canonical sequence as follows:
     763-770: GKPTSLKT → VLPKAAFS
     771-1270: Missing.

Note: Expressed at very low levels in most tissues.
Show »
Length:770
Mass (Da):84,252
Checksum:i46E8EA82686165D8
GO
Isoform 6 (identifier: Q9ULD2-6) [UniParc]FASTAAdd to basket
Also known as: ATIP4

The sequence of this isoform differs from the canonical sequence as follows:
     1-753: Missing.
     754-817: QRIRRVSSSG...SELSTYSNNS → MTVPGGFRSC...LLATFTGKKT

Show »
Length:517
Mass (Da):58,988
Checksum:i43755CC4B064F012
GO
Isoform 7 (identifier: Q9ULD2-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-855: Missing.

Note: No experimental confirmation available.
Show »
Length:415
Mass (Da):48,050
Checksum:i91955F97EA18D77D
GO

Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0U1RQI2A0A0U1RQI2_HUMAN
Microtubule-associated tumor suppre...
MTUS1
41Annotation score:
H0YC63H0YC63_HUMAN
Microtubule-associated tumor suppre...
MTUS1
505Annotation score:

Sequence cautioni

The sequence AAH07328 differs from that shown. Contaminating sequence. Potential poly-A sequence.Curated
The sequence AAH33842 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAB14894 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti266C → G in CAB50791 (PubMed:17974005).Curated1
Sequence conflicti918F → L in BAG37243 (PubMed:14702039).Curated1
Sequence conflicti999E → G in CAH56128 (PubMed:17974005).Curated1
Sequence conflicti1149I → T in BAB14894 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_03517375Q → K in HCC. 1 PublicationCorresponds to variant dbSNP:rs61733703Ensembl.1
Natural variantiVAR_035174148C → R5 PublicationsCorresponds to variant dbSNP:rs3739407Ensembl.1
Natural variantiVAR_035175186T → S in HNSCC cell lines. 1 PublicationCorresponds to variant dbSNP:rs141609607Ensembl.1
Natural variantiVAR_035176425T → M1 PublicationCorresponds to variant dbSNP:rs61733694Ensembl.1
Natural variantiVAR_035177453K → T2 PublicationsCorresponds to variant dbSNP:rs17690844Ensembl.1
Natural variantiVAR_035178563A → S in HCC. 1 Publication1
Natural variantiVAR_035179575H → R2 PublicationsCorresponds to variant dbSNP:rs209569Ensembl.1
Natural variantiVAR_035180873N → H in HCC. 1 PublicationCorresponds to variant dbSNP:rs187103704Ensembl.1
Natural variantiVAR_035181911K → T1 PublicationCorresponds to variant dbSNP:rs61748836Ensembl.1
Natural variantiVAR_0351821063K → T1 PublicationCorresponds to variant dbSNP:rs17853231Ensembl.1
Natural variantiVAR_0351831105E → Q1 PublicationCorresponds to variant dbSNP:rs61733705Ensembl.1
Natural variantiVAR_0351841201Q → R in HCC. 1 PublicationCorresponds to variant dbSNP:rs567116808Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0282701 – 928Missing in isoform 4. 1 PublicationAdd BLAST928
Alternative sequenceiVSP_0448491 – 855Missing in isoform 7. 1 PublicationAdd BLAST855
Alternative sequenceiVSP_0282711 – 834Missing in isoform 3. 4 PublicationsAdd BLAST834
Alternative sequenceiVSP_0282721 – 753Missing in isoform 6. 1 PublicationAdd BLAST753
Alternative sequenceiVSP_028273754 – 817QRIRR…YSNNS → MTVPGGFRSCTETDISSKIF INSTLTPPAGSERHYDATLL TLLVVGSYSLCIIPLLATFT GKKT in isoform 6. 1 PublicationAdd BLAST64
Alternative sequenceiVSP_028274763 – 817GKPTS…YSNNS → A in isoform 2. 1 PublicationAdd BLAST55
Alternative sequenceiVSP_028275763 – 770GKPTSLKT → VLPKAAFS in isoform 5. 1 Publication8
Alternative sequenceiVSP_028276771 – 1270Missing in isoform 5. 1 PublicationAdd BLAST500
Alternative sequenceiVSP_028277835 – 874QNGSS…TALNA → MLLSPKFSLSTIHIRLTAKG LLRNLRLPSGFRRSTVVFHT in isoform 3. 4 PublicationsAdd BLAST40
Alternative sequenceiVSP_028278929 – 946GNTKF…HLLSE → MGCPSSKLCLYSPCAATR in isoform 4. 1 PublicationAdd BLAST18

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF121259 mRNA Translation: AAG33674.1
AF293357 mRNA Translation: AAL37035.1
AK024357 mRNA Translation: BAB14894.1 Different initiation.
AK125188 mRNA Translation: BAG54161.1
AK289750 mRNA Translation: BAF82439.1
AK294860 mRNA Translation: BAG57964.1
AK314692 mRNA Translation: BAG37243.1
AL096842 mRNA Translation: CAB50791.1
BX648879 mRNA Translation: CAH56128.1
AC027117 Genomic DNA No translation available.
AC124069 Genomic DNA No translation available.
CH471080 Genomic DNA Translation: EAW63804.1
CH471080 Genomic DNA Translation: EAW63805.1
CH471080 Genomic DNA Translation: EAW63810.1
BC007328 mRNA Translation: AAH07328.1 Sequence problems.
BC033842 mRNA Translation: AAH33842.1 Different initiation.
BC136320 mRNA Translation: AAI36321.1
BC142971 mRNA Translation: AAI42972.1
AY363099 mRNA Translation: AAQ24172.1
AB033114 mRNA Translation: BAA86602.1
CCDSiCCDS43716.1 [Q9ULD2-2]
CCDS43717.1 [Q9ULD2-1]
CCDS43718.1 [Q9ULD2-6]
CCDS43719.1 [Q9ULD2-3]
CCDS55204.1 [Q9ULD2-7]
CCDS83254.1 [Q9ULD2-4]
RefSeqiNP_001001924.1, NM_001001924.2 [Q9ULD2-1]
NP_001001925.1, NM_001001925.2 [Q9ULD2-2]
NP_001001931.1, NM_001001931.2 [Q9ULD2-6]
NP_001159865.1, NM_001166393.1 [Q9ULD2-7]
NP_001317399.1, NM_001330470.1 [Q9ULD2-4]
NP_065800.1, NM_020749.4 [Q9ULD2-3]
XP_005273636.1, XM_005273579.3
XP_005273639.1, XM_005273582.3
XP_016869189.1, XM_017013700.1
XP_016869190.1, XM_017013701.1
XP_016869191.1, XM_017013702.1
UniGeneiHs.7946

Genome annotation databases

EnsembliENST00000262102; ENSP00000262102; ENSG00000129422 [Q9ULD2-1]
ENST00000297488; ENSP00000297488; ENSG00000129422 [Q9ULD2-3]
ENST00000381861; ENSP00000371285; ENSG00000129422 [Q9ULD2-6]
ENST00000381869; ENSP00000371293; ENSG00000129422 [Q9ULD2-2]
ENST00000519263; ENSP00000430167; ENSG00000129422 [Q9ULD2-2]
ENST00000544260; ENSP00000445738; ENSG00000129422 [Q9ULD2-7]
ENST00000634613; ENSP00000489288; ENSG00000129422 [Q9ULD2-4]
GeneIDi57509
KEGGihsa:57509
UCSCiuc003wxs.4 human [Q9ULD2-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF121259 mRNA Translation: AAG33674.1
AF293357 mRNA Translation: AAL37035.1
AK024357 mRNA Translation: BAB14894.1 Different initiation.
AK125188 mRNA Translation: BAG54161.1
AK289750 mRNA Translation: BAF82439.1
AK294860 mRNA Translation: BAG57964.1
AK314692 mRNA Translation: BAG37243.1
AL096842 mRNA Translation: CAB50791.1
BX648879 mRNA Translation: CAH56128.1
AC027117 Genomic DNA No translation available.
AC124069 Genomic DNA No translation available.
CH471080 Genomic DNA Translation: EAW63804.1
CH471080 Genomic DNA Translation: EAW63805.1
CH471080 Genomic DNA Translation: EAW63810.1
BC007328 mRNA Translation: AAH07328.1 Sequence problems.
BC033842 mRNA Translation: AAH33842.1 Different initiation.
BC136320 mRNA Translation: AAI36321.1
BC142971 mRNA Translation: AAI42972.1
AY363099 mRNA Translation: AAQ24172.1
AB033114 mRNA Translation: BAA86602.1
CCDSiCCDS43716.1 [Q9ULD2-2]
CCDS43717.1 [Q9ULD2-1]
CCDS43718.1 [Q9ULD2-6]
CCDS43719.1 [Q9ULD2-3]
CCDS55204.1 [Q9ULD2-7]
CCDS83254.1 [Q9ULD2-4]
RefSeqiNP_001001924.1, NM_001001924.2 [Q9ULD2-1]
NP_001001925.1, NM_001001925.2 [Q9ULD2-2]
NP_001001931.1, NM_001001931.2 [Q9ULD2-6]
NP_001159865.1, NM_001166393.1 [Q9ULD2-7]
NP_001317399.1, NM_001330470.1 [Q9ULD2-4]
NP_065800.1, NM_020749.4 [Q9ULD2-3]
XP_005273636.1, XM_005273579.3
XP_005273639.1, XM_005273582.3
XP_016869189.1, XM_017013700.1
XP_016869190.1, XM_017013701.1
XP_016869191.1, XM_017013702.1
UniGeneiHs.7946

3D structure databases

ProteinModelPortaliQ9ULD2
SMRiQ9ULD2
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi121573, 24 interactors
IntActiQ9ULD2, 25 interactors
STRINGi9606.ENSP00000262102

PTM databases

iPTMnetiQ9ULD2
PhosphoSitePlusiQ9ULD2

Polymorphism and mutation databases

BioMutaiMTUS1
DMDMi158706128

Proteomic databases

EPDiQ9ULD2
PaxDbiQ9ULD2
PeptideAtlasiQ9ULD2
PRIDEiQ9ULD2
ProteomicsDBi84989
84990 [Q9ULD2-2]
84991 [Q9ULD2-3]
84992 [Q9ULD2-4]
84993 [Q9ULD2-5]
84994 [Q9ULD2-6]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000262102; ENSP00000262102; ENSG00000129422 [Q9ULD2-1]
ENST00000297488; ENSP00000297488; ENSG00000129422 [Q9ULD2-3]
ENST00000381861; ENSP00000371285; ENSG00000129422 [Q9ULD2-6]
ENST00000381869; ENSP00000371293; ENSG00000129422 [Q9ULD2-2]
ENST00000519263; ENSP00000430167; ENSG00000129422 [Q9ULD2-2]
ENST00000544260; ENSP00000445738; ENSG00000129422 [Q9ULD2-7]
ENST00000634613; ENSP00000489288; ENSG00000129422 [Q9ULD2-4]
GeneIDi57509
KEGGihsa:57509
UCSCiuc003wxs.4 human [Q9ULD2-1]

Organism-specific databases

CTDi57509
DisGeNETi57509
EuPathDBiHostDB:ENSG00000129422.14
GeneCardsiMTUS1
HGNCiHGNC:29789 MTUS1
HPAiHPA067903
HPA069795
MalaCardsiMTUS1
MIMi114550 phenotype
609589 gene
neXtProtiNX_Q9ULD2
OpenTargetsiENSG00000129422
PharmGKBiPA134968054
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IEXM Eukaryota
ENOG41118DX LUCA
GeneTreeiENSGT00390000006245
HOGENOMiHOG000013016
HOVERGENiHBG108158
InParanoidiQ9ULD2
OMAiNASHKVP
OrthoDBiEOG091G0DE4
PhylomeDBiQ9ULD2
TreeFamiTF333416

Miscellaneous databases

ChiTaRSiMTUS1 human
GeneWikiiMTUS1
GenomeRNAii57509
PROiPR:Q9ULD2
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000129422 Expressed in 241 organ(s), highest expression level in corpus callosum
CleanExiHS_MTUS1
ExpressionAtlasiQ9ULD2 baseline and differential
GenevisibleiQ9ULD2 HS

Family and domain databases

InterProiView protein in InterPro
IPR029786 MTUS1
PANTHERiPTHR24200:SF7 PTHR24200:SF7, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiMTUS1_HUMAN
AccessioniPrimary (citable) accession number: Q9ULD2
Secondary accession number(s): A8K135
, B2RBJ6, B3KWJ9, B4DH03, B9EGA1, D3DSP8, Q63HJ6, Q659F4, Q6PK49, Q6URW7, Q8N4M6, Q8WTT9, Q9H7T2
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 2, 2007
Last sequence update: October 2, 2007
Last modified: November 7, 2018
This is version 134 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human chromosome 8
    Human chromosome 8: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again