Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 183 (07 Oct 2020)
Sequence version 1 (01 May 2000)
Previous versions | rss
Add a publicationFeedback
Protein

Long-chain-fatty-acid--CoA ligase 5

Gene

ACSL5

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Catalyzes the conversion of long-chain fatty acids to their active form acyl-CoAs for both synthesis of cellular lipids, and degradation via beta-oxidation (PubMed:17681178, PubMed:24269233, PubMed:22633490). ACSL5 may activate fatty acids from exogenous sources for the synthesis of triacylglycerol destined for intracellular storage (By similarity). Utilizes a wide range of saturated fatty acids with a preference for C16-C18 unsaturated fatty acids (By similarity). It was suggested that it may also stimulate fatty acid oxidation (By similarity). At the villus tip of the crypt-villus axis of the small intestine may sensitize epithelial cells to apoptosis specifically triggered by the death ligand TRAIL. May have a role in the survival of glioma cells.By similarity5 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the 'Function' section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Mg2+By similarity

<p>This subsection of the 'Function' section describes biophysical and chemical properties, such as maximal absorption, kinetic parameters, pH dependence, redox potentials and temperature dependence.<p><a href='/help/biophysicochemical_properties' target='_top'>More...</a></p>Kineticsi

  1. KM=0.11 µM for palmitic acid (at pH 7.5)1 Publication
  2. KM=0.38 µM for palmitic acid (at pH 9.5)1 Publication
    1. KM=0.04 µM for palmitic acid (at pH 7.5)1 Publication
    2. KM=0.15 µM for palmitic acid (at pH 8.5)1 Publication

      pH dependencei

      Optimum pH is 9.5.1 Publication
      Optimum pH is 7.5-8.5.1 Publication

      <p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

      GO - Biological processi

      <p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

      Molecular functionLigase
      Biological processFatty acid metabolism, Lipid metabolism
      LigandATP-binding, Magnesium, Nucleotide-binding

      Enzyme and pathway databases

      BioCyc Collection of Pathway/Genome Databases

      More...
      BioCyci
      MetaCyc:HS01349-MONOMER

      Pathway Commons web resource for biological pathway data

      More...
      PathwayCommonsi
      Q9ULC5

      Reactome - a knowledgebase of biological pathways and processes

      More...
      Reactomei
      R-HSA-75876, Synthesis of very long-chain fatty acyl-CoAs

      SABIO-RK: Biochemical Reaction Kinetics Database

      More...
      SABIO-RKi
      Q9ULC5

      Chemistry databases

      SwissLipids knowledge resource for lipid biology

      More...
      SwissLipidsi
      SLP:000000202
      SLP:000000517 [Q9ULC5-3]
      SLP:000000518 [Q9ULC5-1]

      <p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

      <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
      Recommended name:
      Long-chain-fatty-acid--CoA ligase 5Curated (EC:6.2.1.33 Publications)
      Alternative name(s):
      Arachidonate--CoA ligaseCurated (EC:6.2.1.15By similarity)
      Long-chain acyl-CoA synthetase 5
      Short name:
      LACS 5
      <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
      Name:ACSL5Imported
      Synonyms:ACS51 Publication, FACL51 Publication
      ORF Names:UNQ633/PRO1250
      <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
      <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
      <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
      <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
      • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 10

      Organism-specific databases

      Eukaryotic Pathogen Database Resources

      More...
      EuPathDBi
      HostDB:ENSG00000197142.10

      Human Gene Nomenclature Database

      More...
      HGNCi
      HGNC:16526, ACSL5

      Online Mendelian Inheritance in Man (OMIM)

      More...
      MIMi
      605677, gene

      neXtProt; the human protein knowledge platform

      More...
      neXtProti
      NX_Q9ULC5

      <p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

      Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

      Topology

      Feature keyPosition(s)DescriptionActionsGraphical viewLength
      <p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei12 – 32Helical; Signal-anchor for type III membrane proteinSequence analysisAdd BLAST21
      <p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini33 – 683CytoplasmicSequence analysisAdd BLAST651

      Keywords - Cellular componenti

      Cell membrane, Endoplasmic reticulum, Membrane, Mitochondrion, Mitochondrion outer membrane

      <p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

      Organism-specific databases

      DisGeNET

      More...
      DisGeNETi
      51703

      Open Targets

      More...
      OpenTargetsi
      ENSG00000197142

      The Pharmacogenetics and Pharmacogenomics Knowledge Base

      More...
      PharmGKBi
      PA27969

      Miscellaneous databases

      Pharos NIH Druggable Genome Knowledgebase

      More...
      Pharosi
      Q9ULC5, Tbio

      Chemistry databases

      ChEMBL database of bioactive drug-like small molecules

      More...
      ChEMBLi
      CHEMBL4105818

      Polymorphism and mutation databases

      BioMuta curated single-nucleotide variation and disease association database

      More...
      BioMutai
      ACSL5

      Domain mapping of disease mutations (DMDM)

      More...
      DMDMi
      13431659

      <p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

      Molecule processing

      Feature keyPosition(s)DescriptionActionsGraphical viewLength
      <p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001931121 – 683Long-chain-fatty-acid--CoA ligase 5Add BLAST683

      Amino acid modifications

      Feature keyPosition(s)DescriptionActionsGraphical viewLength
      <p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei361N6-acetyllysineBy similarity1
      Isoform 2 (identifier: Q9ULC5-3)
      Modified residuei32PhosphoserineCombined sources1

      Keywords - PTMi

      Acetylation, Phosphoprotein

      Proteomic databases

      Encyclopedia of Proteome Dynamics

      More...
      EPDi
      Q9ULC5

      jPOST - Japan Proteome Standard Repository/Database

      More...
      jPOSTi
      Q9ULC5

      MassIVE - Mass Spectrometry Interactive Virtual Environment

      More...
      MassIVEi
      Q9ULC5

      PaxDb, a database of protein abundance averages across all three domains of life

      More...
      PaxDbi
      Q9ULC5

      PeptideAtlas

      More...
      PeptideAtlasi
      Q9ULC5

      PRoteomics IDEntifications database

      More...
      PRIDEi
      Q9ULC5

      ProteomicsDB: a multi-organism proteome resource

      More...
      ProteomicsDBi
      84979 [Q9ULC5-1]
      84980 [Q9ULC5-3]
      84981 [Q9ULC5-4]

      PTM databases

      iPTMnet integrated resource for PTMs in systems biology context

      More...
      iPTMneti
      Q9ULC5

      Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

      More...
      PhosphoSitePlusi
      Q9ULC5

      SwissPalm database of S-palmitoylation events

      More...
      SwissPalmi
      Q9ULC5

      <p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

      Gene expression databases

      Bgee dataBase for Gene Expression Evolution

      More...
      Bgeei
      ENSG00000197142, Expressed in jejunal mucosa and 218 other tissues

      Genevisible search portal to normalized and curated expression data from Genevestigator

      More...
      Genevisiblei
      Q9ULC5, HS

      Organism-specific databases

      Human Protein Atlas

      More...
      HPAi
      ENSG00000197142, Tissue enriched (intestine)

      <p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

      <p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

      Hide details

      Protein-protein interaction databases

      The Biological General Repository for Interaction Datasets (BioGRID)

      More...
      BioGRIDi
      119687, 18 interactors

      Protein interaction database and analysis system

      More...
      IntActi
      Q9ULC5, 27 interactors

      Molecular INTeraction database

      More...
      MINTi
      Q9ULC5

      STRING: functional protein association networks

      More...
      STRINGi
      9606.ENSP00000348429

      Miscellaneous databases

      RNAct, Protein-RNA interaction predictions for model organisms.

      More...
      RNActi
      Q9ULC5, protein

      <p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

      3D structure databases

      SWISS-MODEL Repository - a database of annotated 3D protein structure models

      More...
      SMRi
      Q9ULC5

      Database of comparative protein structure models

      More...
      ModBasei
      Search...

      <p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

      <p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

      Keywords - Domaini

      Signal-anchor, Transmembrane, Transmembrane helix

      Phylogenomic databases

      evolutionary genealogy of genes: Non-supervised Orthologous Groups

      More...
      eggNOGi
      KOG1256, Eukaryota

      Ensembl GeneTree

      More...
      GeneTreei
      ENSGT00940000156651

      The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

      More...
      HOGENOMi
      CLU_000022_45_4_1

      InParanoid: Eukaryotic Ortholog Groups

      More...
      InParanoidi
      Q9ULC5

      KEGG Orthology (KO)

      More...
      KOi
      K01897

      Identification of Orthologs from Complete Genome Data

      More...
      OMAi
      LAVPYIF

      Database of Orthologous Groups

      More...
      OrthoDBi
      630541at2759

      Database for complete collections of gene phylogenies

      More...
      PhylomeDBi
      Q9ULC5

      TreeFam database of animal gene trees

      More...
      TreeFami
      TF313877

      Family and domain databases

      Gene3D Structural and Functional Annotation of Protein Families

      More...
      Gene3Di
      3.40.50.12780, 2 hits

      Integrated resource of protein families, domains and functional sites

      More...
      InterProi
      View protein in InterPro
      IPR020845, AMP-binding_CS
      IPR000873, AMP-dep_Synth/Lig
      IPR042099, AMP-dep_Synthh-like_sf

      Pfam protein domain database

      More...
      Pfami
      View protein in Pfam
      PF00501, AMP-binding, 1 hit

      PROSITE; a protein domain and family database

      More...
      PROSITEi
      View protein in PROSITE
      PS00455, AMP_BINDING, 1 hit

      <p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3)i

      <p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

      This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
      Isoform 1 (identifier: Q9ULC5-1) [UniParc]FASTAAdd to basket
      Also known as: ACSL5b, ACSL5-fl

      This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

      « Hide
              10         20         30         40         50
      MLFIFNFLFS PLPTPALICI LTFGAAIFLW LITRPQPVLP LLDLNNQSVG
      60 70 80 90 100
      IEGGARKGVS QKNNDLTSCC FSDAKTMYEV FQRGLAVSDN GPCLGYRKPN
      110 120 130 140 150
      QPYRWLSYKQ VSDRAEYLGS CLLHKGYKSS PDQFVGIFAQ NRPEWIISEL
      160 170 180 190 200
      ACYTYSMVAV PLYDTLGPEA IVHIVNKADI AMVICDTPQK ALVLIGNVEK
      210 220 230 240 250
      GFTPSLKVII LMDPFDDDLK QRGEKSGIEI LSLYDAENLG KEHFRKPVPP
      260 270 280 290 300
      SPEDLSVICF TSGTTGDPKG AMITHQNIVS NAAAFLKCVE HAYEPTPDDV
      310 320 330 340 350
      AISYLPLAHM FERIVQAVVY SCGARVGFFQ GDIRLLADDM KTLKPTLFPA
      360 370 380 390 400
      VPRLLNRIYD KVQNEAKTPL KKFLLKLAVS SKFKELQKGI IRHDSFWDKL
      410 420 430 440 450
      IFAKIQDSLG GRVRVIVTGA APMSTSVMTF FRAAMGCQVY EAYGQTECTG
      460 470 480 490 500
      GCTFTLPGDW TSGHVGVPLA CNYVKLEDVA DMNYFTVNNE GEVCIKGTNV
      510 520 530 540 550
      FKGYLKDPEK TQEALDSDGW LHTGDIGRWL PNGTLKIIDR KKNIFKLAQG
      560 570 580 590 600
      EYIAPEKIEN IYNRSQPVLQ IFVHGESLRS SLVGVVVPDT DVLPSFAAKL
      610 620 630 640 650
      GVKGSFEELC QNQVVREAIL EDLQKIGKES GLKTFEQVKA IFLHPEPFSI
      660 670 680
      ENGLLTPTLK AKRGELSKYF RTQIDSLYEH IQD
      Note: Localize in mitochondrion and endoplasmic reticulum.
      Length:683
      Mass (Da):75,991
      Last modified:May 1, 2000 - v1
      <p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i781AFE1A7A78C286
      GO
      Isoform 2 (identifier: Q9ULC5-3) [UniParc]FASTAAdd to basket
      Also known as: ACSL5a

      The sequence of this isoform differs from the canonical sequence as follows:
           1-1: M → MDALKPPCLWRNHERGKKDRDSCGRKNSEPGSPHSLEALRDAAPSQGLNFLLLFTKM

      Show »
      Length:739
      Mass (Da):82,263
      Checksum:iC3A1ABCA53717BCE
      GO
      Isoform 3 (identifier: Q9ULC5-4) [UniParc]FASTAAdd to basket
      Also known as: ACSL5delta20

      The sequence of this isoform differs from the canonical sequence as follows:
           614-637: Missing.

      Note: Localize in mitochondrion and endoplasmic reticulum.Curated
      Show »
      Length:659
      Mass (Da):73,278
      Checksum:i8FA678B997F35EF7
      GO

      <p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

      The sequence BAA85979 differs from that shown. Reason: Erroneous initiation.Curated
      The sequence BAA86054 differs from that shown. Reason: Erroneous gene model prediction.Curated

      Natural variant

      Feature keyPosition(s)DescriptionActionsGraphical viewLength
      <p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_022117182M → V. Corresponds to variant dbSNP:rs3736946Ensembl.1
      Natural variantiVAR_036377388K → R in a colorectal cancer sample; somatic mutation. 1 Publication1
      Natural variantiVAR_036378466G → D in a colorectal cancer sample; somatic mutation. 1 Publication1
      Natural variantiVAR_048240486T → A. Corresponds to variant dbSNP:rs12254915Ensembl.1

      Alternative sequence

      Feature keyPosition(s)DescriptionActionsGraphical viewLength
      <p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0379471M → MDALKPPCLWRNHERGKKDR DSCGRKNSEPGSPHSLEALR DAAPSQGLNFLLLFTKM in isoform 2. 3 Publications1
      Alternative sequenceiVSP_038233614 – 637Missing in isoform 3. 1 PublicationAdd BLAST24

      Sequence databases

      Select the link destinations:

      EMBL nucleotide sequence database

      More...
      EMBLi

      GenBank nucleotide sequence database

      More...
      GenBanki

      DNA Data Bank of Japan; a nucleotide sequence database

      More...
      DDBJi
      Links Updated
      AM262166 mRNA Translation: CAK18174.1
      AY358520 mRNA Translation: AAQ88884.1
      AK000339 mRNA No translation available.
      AK222782 mRNA No translation available.
      AL157786 Genomic DNA No translation available.
      CH471066 Genomic DNA Translation: EAW49532.1
      CH471066 Genomic DNA Translation: EAW49535.1
      CH471066 Genomic DNA Translation: EAW49536.1
      CH471066 Genomic DNA Translation: EAW49539.1
      BC007985 mRNA Translation: AAH07985.2
      AB033899 mRNA Translation: BAA85979.1 Different initiation.
      AB033920 Genomic DNA Translation: BAA86054.1 Sequence problems.

      The Consensus CDS (CCDS) project

      More...
      CCDSi
      CCDS7572.1 [Q9ULC5-3]
      CCDS7573.1 [Q9ULC5-1]

      NCBI Reference Sequences

      More...
      RefSeqi
      NP_057318.2, NM_016234.3 [Q9ULC5-3]
      NP_976313.1, NM_203379.1 [Q9ULC5-1]
      NP_976314.1, NM_203380.1 [Q9ULC5-1]

      Genome annotation databases

      Ensembl eukaryotic genome annotation project

      More...
      Ensembli
      ENST00000354273; ENSP00000346223; ENSG00000197142 [Q9ULC5-1]
      ENST00000354655; ENSP00000346680; ENSG00000197142 [Q9ULC5-1]
      ENST00000356116; ENSP00000348429; ENSG00000197142 [Q9ULC5-3]
      ENST00000393081; ENSP00000376796; ENSG00000197142 [Q9ULC5-1]
      ENST00000433418; ENSP00000403647; ENSG00000197142 [Q9ULC5-4]

      Database of genes from NCBI RefSeq genomes

      More...
      GeneIDi
      51703

      KEGG: Kyoto Encyclopedia of Genes and Genomes

      More...
      KEGGi
      hsa:51703

      UCSC genome browser

      More...
      UCSCi
      uc001kzs.4, human [Q9ULC5-1]

      Keywords - Coding sequence diversityi

      Alternative splicing, Polymorphism

      <p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

      <p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

      Sequence databases

      Select the link destinations:
      EMBLi
      GenBanki
      DDBJi
      Links Updated
      AM262166 mRNA Translation: CAK18174.1
      AY358520 mRNA Translation: AAQ88884.1
      AK000339 mRNA No translation available.
      AK222782 mRNA No translation available.
      AL157786 Genomic DNA No translation available.
      CH471066 Genomic DNA Translation: EAW49532.1
      CH471066 Genomic DNA Translation: EAW49535.1
      CH471066 Genomic DNA Translation: EAW49536.1
      CH471066 Genomic DNA Translation: EAW49539.1
      BC007985 mRNA Translation: AAH07985.2
      AB033899 mRNA Translation: BAA85979.1 Different initiation.
      AB033920 Genomic DNA Translation: BAA86054.1 Sequence problems.
      CCDSiCCDS7572.1 [Q9ULC5-3]
      CCDS7573.1 [Q9ULC5-1]
      RefSeqiNP_057318.2, NM_016234.3 [Q9ULC5-3]
      NP_976313.1, NM_203379.1 [Q9ULC5-1]
      NP_976314.1, NM_203380.1 [Q9ULC5-1]

      3D structure databases

      SMRiQ9ULC5
      ModBaseiSearch...

      Protein-protein interaction databases

      BioGRIDi119687, 18 interactors
      IntActiQ9ULC5, 27 interactors
      MINTiQ9ULC5
      STRINGi9606.ENSP00000348429

      Chemistry databases

      ChEMBLiCHEMBL4105818
      SwissLipidsiSLP:000000202
      SLP:000000517 [Q9ULC5-3]
      SLP:000000518 [Q9ULC5-1]

      PTM databases

      iPTMnetiQ9ULC5
      PhosphoSitePlusiQ9ULC5
      SwissPalmiQ9ULC5

      Polymorphism and mutation databases

      BioMutaiACSL5
      DMDMi13431659

      Proteomic databases

      EPDiQ9ULC5
      jPOSTiQ9ULC5
      MassIVEiQ9ULC5
      PaxDbiQ9ULC5
      PeptideAtlasiQ9ULC5
      PRIDEiQ9ULC5
      ProteomicsDBi84979 [Q9ULC5-1]
      84980 [Q9ULC5-3]
      84981 [Q9ULC5-4]

      Protocols and materials databases

      Antibodypedia a portal for validated antibodies

      More...
      Antibodypediai
      31809, 257 antibodies

      The DNASU plasmid repository

      More...
      DNASUi
      51703

      Genome annotation databases

      EnsembliENST00000354273; ENSP00000346223; ENSG00000197142 [Q9ULC5-1]
      ENST00000354655; ENSP00000346680; ENSG00000197142 [Q9ULC5-1]
      ENST00000356116; ENSP00000348429; ENSG00000197142 [Q9ULC5-3]
      ENST00000393081; ENSP00000376796; ENSG00000197142 [Q9ULC5-1]
      ENST00000433418; ENSP00000403647; ENSG00000197142 [Q9ULC5-4]
      GeneIDi51703
      KEGGihsa:51703
      UCSCiuc001kzs.4, human [Q9ULC5-1]

      Organism-specific databases

      Comparative Toxicogenomics Database

      More...
      CTDi
      51703
      DisGeNETi51703
      EuPathDBiHostDB:ENSG00000197142.10

      GeneCards: human genes, protein and diseases

      More...
      GeneCardsi
      ACSL5
      HGNCiHGNC:16526, ACSL5
      HPAiENSG00000197142, Tissue enriched (intestine)
      MIMi605677, gene
      neXtProtiNX_Q9ULC5
      OpenTargetsiENSG00000197142
      PharmGKBiPA27969

      GenAtlas: human gene database

      More...
      GenAtlasi
      Search...

      Phylogenomic databases

      eggNOGiKOG1256, Eukaryota
      GeneTreeiENSGT00940000156651
      HOGENOMiCLU_000022_45_4_1
      InParanoidiQ9ULC5
      KOiK01897
      OMAiLAVPYIF
      OrthoDBi630541at2759
      PhylomeDBiQ9ULC5
      TreeFamiTF313877

      Enzyme and pathway databases

      BioCyciMetaCyc:HS01349-MONOMER
      PathwayCommonsiQ9ULC5
      ReactomeiR-HSA-75876, Synthesis of very long-chain fatty acyl-CoAs
      SABIO-RKiQ9ULC5

      Miscellaneous databases

      BioGRID ORCS database of CRISPR phenotype screens

      More...
      BioGRID-ORCSi
      51703, 14 hits in 867 CRISPR screens

      ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

      More...
      ChiTaRSi
      ACSL5, human

      The Gene Wiki collection of pages on human genes and proteins

      More...
      GeneWikii
      ACSL5

      Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

      More...
      GenomeRNAii
      51703
      PharosiQ9ULC5, Tbio

      Protein Ontology

      More...
      PROi
      PR:Q9ULC5
      RNActiQ9ULC5, protein

      The Stanford Online Universal Resource for Clones and ESTs

      More...
      SOURCEi
      Search...

      Gene expression databases

      BgeeiENSG00000197142, Expressed in jejunal mucosa and 218 other tissues
      GenevisibleiQ9ULC5, HS

      Family and domain databases

      Gene3Di3.40.50.12780, 2 hits
      InterProiView protein in InterPro
      IPR020845, AMP-binding_CS
      IPR000873, AMP-dep_Synth/Lig
      IPR042099, AMP-dep_Synthh-like_sf
      PfamiView protein in Pfam
      PF00501, AMP-binding, 1 hit
      PROSITEiView protein in PROSITE
      PS00455, AMP_BINDING, 1 hit

      ProtoNet; Automatic hierarchical classification of proteins

      More...
      ProtoNeti
      Search...

      MobiDB: a database of protein disorder and mobility annotations

      More...
      MobiDBi
      Search...

      <p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

      <p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiACSL5_HUMAN
      <p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9ULC5
      Secondary accession number(s): A6GV77
      , D3DRB3, Q6UX44, Q9UIU4
      <p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 27, 2001
      Last sequence update: May 1, 2000
      Last modified: October 7, 2020
      This is version 183 of the entry and version 1 of the sequence. See complete history.
      <p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
      Annotation programChordata Protein Annotation Program
      DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

      <p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

      Keywords - Technical termi

      Reference proteome

      Documents

      1. Human chromosome 10
        Human chromosome 10: entries, gene names and cross-references to MIM
      2. Human polymorphisms and disease mutations
        Index of human polymorphisms and disease mutations
      3. MIM cross-references
        Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
      4. SIMILARITY comments
        Index of protein domains and families
      5. Human entries with polymorphisms or disease mutations
        List of human entries with polymorphisms or disease mutations
      UniProt is an ELIXIR core data resource
      Main funding by: National Institutes of Health

      We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

      Do not show this banner again