Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 177 (13 Nov 2019)
Sequence version 1 (01 May 2000)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Long-chain-fatty-acid--CoA ligase 5

Gene

ACSL5

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Catalyzes the conversion of long-chain fatty acids to their active form acyl-CoAs for both synthesis of cellular lipids, and degradation via beta-oxidation (PubMed:17681178, PubMed:24269233, PubMed:22633490). ACSL5 may activate fatty acids from exogenous sources for the synthesis of triacylglycerol destined for intracellular storage (By similarity). Utilizes a wide range of saturated fatty acids with a preference for C16-C18 unsaturated fatty acids (By similarity). It was suggested that it may also stimulate fatty acid oxidation (By similarity). At the villus tip of the crypt-villus axis of the small intestine may sensitize epithelial cells to apoptosis specifically triggered by the death ligand TRAIL. May have a role in the survival of glioma cells.By similarity5 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the ‘Function’ section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Mg2+By similarity

<p>This subsection of the ‘Function’ section describes biophysical and chemical properties, such as maximal absorption, kinetic parameters, pH dependence, redox potentials and temperature dependence.<p><a href='/help/biophysicochemical_properties' target='_top'>More...</a></p>Kineticsi

  1. KM=0.11 µM for palmitic acid (isoform 1 at pH 7.5)1 Publication
  2. KM=0.38 µM for palmitic acid (isoform 1 at pH 9.5)1 Publication
  3. KM=0.04 µM for palmitic acid (isoform 3 at pH 7.5)1 Publication
  4. KM=0.15 µM for palmitic acid (isoform 3 at pH 8.5)1 Publication

    pH dependencei

    Optimum pH is 9.5 (isoform 1), 7.5-8.5 (isoform 3).1 Publication

    <p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

    GO - Biological processi

    <p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

    Molecular functionLigase
    Biological processFatty acid metabolism, Lipid metabolism
    LigandATP-binding, Magnesium, Nucleotide-binding

    Enzyme and pathway databases

    BioCyc Collection of Pathway/Genome Databases

    More...
    BioCyci
    MetaCyc:HS01349-MONOMER

    Reactome - a knowledgebase of biological pathways and processes

    More...
    Reactomei
    R-HSA-75876 Synthesis of very long-chain fatty acyl-CoAs

    SABIO-RK: Biochemical Reaction Kinetics Database

    More...
    SABIO-RKi
    Q9ULC5

    Chemistry databases

    SwissLipids knowledge resource for lipid biology

    More...
    SwissLipidsi
    SLP:000000202
    SLP:000000517 [Q9ULC5-3]
    SLP:000000518 [Q9ULC5-1]

    <p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
    Recommended name:
    Long-chain-fatty-acid--CoA ligase 5Curated (EC:6.2.1.33 Publications)
    Alternative name(s):
    Arachidonate--CoA ligaseCurated (EC:6.2.1.15By similarity)
    Long-chain acyl-CoA synthetase 5
    Short name:
    LACS 5
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
    Name:ACSL5Imported
    Synonyms:ACS51 Publication, FACL51 Publication
    ORF Names:UNQ633/PRO1250
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
    • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 10

    Organism-specific databases

    Human Gene Nomenclature Database

    More...
    HGNCi
    HGNC:16526 ACSL5

    Online Mendelian Inheritance in Man (OMIM)

    More...
    MIMi
    605677 gene

    neXtProt; the human protein knowledge platform

    More...
    neXtProti
    NX_Q9ULC5

    <p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

    Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

    Topology

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei12 – 32Helical; Signal-anchor for type III membrane proteinSequence analysisAdd BLAST21
    <p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini33 – 683CytoplasmicSequence analysisAdd BLAST651

    Keywords - Cellular componenti

    Cell membrane, Endoplasmic reticulum, Membrane, Mitochondrion, Mitochondrion outer membrane

    <p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

    Organism-specific databases

    DisGeNET

    More...
    DisGeNETi
    51703

    Open Targets

    More...
    OpenTargetsi
    ENSG00000197142

    The Pharmacogenetics and Pharmacogenomics Knowledge Base

    More...
    PharmGKBi
    PA27969

    Miscellaneous databases

    Pharos NIH Druggable Genome Knowledgebase

    More...
    Pharosi
    Q9ULC5

    Chemistry databases

    ChEMBL database of bioactive drug-like small molecules

    More...
    ChEMBLi
    CHEMBL4105818

    Polymorphism and mutation databases

    BioMuta curated single-nucleotide variation and disease association database

    More...
    BioMutai
    ACSL5

    Domain mapping of disease mutations (DMDM)

    More...
    DMDMi
    13431659

    <p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

    Molecule processing

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001931121 – 683Long-chain-fatty-acid--CoA ligase 5Add BLAST683

    Amino acid modifications

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei361N6-acetyllysineBy similarity1
    Isoform 2 (identifier: Q9ULC5-3)
    Modified residuei32PhosphoserineCombined sources1

    Keywords - PTMi

    Acetylation, Phosphoprotein

    Proteomic databases

    Encyclopedia of Proteome Dynamics

    More...
    EPDi
    Q9ULC5

    jPOST - Japan Proteome Standard Repository/Database

    More...
    jPOSTi
    Q9ULC5

    MassIVE - Mass Spectrometry Interactive Virtual Environment

    More...
    MassIVEi
    Q9ULC5

    PaxDb, a database of protein abundance averages across all three domains of life

    More...
    PaxDbi
    Q9ULC5

    PeptideAtlas

    More...
    PeptideAtlasi
    Q9ULC5

    PRoteomics IDEntifications database

    More...
    PRIDEi
    Q9ULC5

    ProteomicsDB: a multi-organism proteome resource

    More...
    ProteomicsDBi
    84979 [Q9ULC5-1]
    84980 [Q9ULC5-3]
    84981 [Q9ULC5-4]

    PTM databases

    iPTMnet integrated resource for PTMs in systems biology context

    More...
    iPTMneti
    Q9ULC5

    Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

    More...
    PhosphoSitePlusi
    Q9ULC5

    SwissPalm database of S-palmitoylation events

    More...
    SwissPalmi
    Q9ULC5

    <p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

    Gene expression databases

    Bgee dataBase for Gene Expression Evolution

    More...
    Bgeei
    ENSG00000197142 Expressed in 205 organ(s), highest expression level in jejunal mucosa

    Genevisible search portal to normalized and curated expression data from Genevestigator

    More...
    Genevisiblei
    Q9ULC5 HS

    Organism-specific databases

    Human Protein Atlas

    More...
    HPAi
    CAB035986
    CAB062546
    HPA007162

    <p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

    Protein-protein interaction databases

    The Biological General Repository for Interaction Datasets (BioGrid)

    More...
    BioGridi
    119687, 7 interactors

    Protein interaction database and analysis system

    More...
    IntActi
    Q9ULC5, 19 interactors

    Molecular INTeraction database

    More...
    MINTi
    Q9ULC5

    STRING: functional protein association networks

    More...
    STRINGi
    9606.ENSP00000348429

    <p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

    3D structure databases

    SWISS-MODEL Repository - a database of annotated 3D protein structure models

    More...
    SMRi
    Q9ULC5

    Database of comparative protein structure models

    More...
    ModBasei
    Search...

    <p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

    <p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

    Keywords - Domaini

    Signal-anchor, Transmembrane, Transmembrane helix

    Phylogenomic databases

    evolutionary genealogy of genes: Non-supervised Orthologous Groups

    More...
    eggNOGi
    KOG1256 Eukaryota
    COG1022 LUCA

    Ensembl GeneTree

    More...
    GeneTreei
    ENSGT00940000156651

    The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

    More...
    HOGENOMi
    HOG000159459

    InParanoid: Eukaryotic Ortholog Groups

    More...
    InParanoidi
    Q9ULC5

    KEGG Orthology (KO)

    More...
    KOi
    K01897

    Identification of Orthologs from Complete Genome Data

    More...
    OMAi
    AIWMAGH

    Database of Orthologous Groups

    More...
    OrthoDBi
    947804at2759

    Database for complete collections of gene phylogenies

    More...
    PhylomeDBi
    Q9ULC5

    TreeFam database of animal gene trees

    More...
    TreeFami
    TF313877

    Family and domain databases

    Gene3D Structural and Functional Annotation of Protein Families

    More...
    Gene3Di
    3.40.50.12780, 2 hits

    Integrated resource of protein families, domains and functional sites

    More...
    InterProi
    View protein in InterPro
    IPR020845 AMP-binding_CS
    IPR000873 AMP-dep_Synth/Lig
    IPR042099 AMP-dep_Synthh-like_sf

    Pfam protein domain database

    More...
    Pfami
    View protein in Pfam
    PF00501 AMP-binding, 1 hit

    PROSITE; a protein domain and family database

    More...
    PROSITEi
    View protein in PROSITE
    PS00455 AMP_BINDING, 1 hit

    <p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3)i

    <p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

    This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
    Isoform 1 (identifier: Q9ULC5-1) [UniParc]FASTAAdd to basket
    Also known as: ACSL5b, ACSL5-fl

    This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide
            10         20         30         40         50
    MLFIFNFLFS PLPTPALICI LTFGAAIFLW LITRPQPVLP LLDLNNQSVG
    60 70 80 90 100
    IEGGARKGVS QKNNDLTSCC FSDAKTMYEV FQRGLAVSDN GPCLGYRKPN
    110 120 130 140 150
    QPYRWLSYKQ VSDRAEYLGS CLLHKGYKSS PDQFVGIFAQ NRPEWIISEL
    160 170 180 190 200
    ACYTYSMVAV PLYDTLGPEA IVHIVNKADI AMVICDTPQK ALVLIGNVEK
    210 220 230 240 250
    GFTPSLKVII LMDPFDDDLK QRGEKSGIEI LSLYDAENLG KEHFRKPVPP
    260 270 280 290 300
    SPEDLSVICF TSGTTGDPKG AMITHQNIVS NAAAFLKCVE HAYEPTPDDV
    310 320 330 340 350
    AISYLPLAHM FERIVQAVVY SCGARVGFFQ GDIRLLADDM KTLKPTLFPA
    360 370 380 390 400
    VPRLLNRIYD KVQNEAKTPL KKFLLKLAVS SKFKELQKGI IRHDSFWDKL
    410 420 430 440 450
    IFAKIQDSLG GRVRVIVTGA APMSTSVMTF FRAAMGCQVY EAYGQTECTG
    460 470 480 490 500
    GCTFTLPGDW TSGHVGVPLA CNYVKLEDVA DMNYFTVNNE GEVCIKGTNV
    510 520 530 540 550
    FKGYLKDPEK TQEALDSDGW LHTGDIGRWL PNGTLKIIDR KKNIFKLAQG
    560 570 580 590 600
    EYIAPEKIEN IYNRSQPVLQ IFVHGESLRS SLVGVVVPDT DVLPSFAAKL
    610 620 630 640 650
    GVKGSFEELC QNQVVREAIL EDLQKIGKES GLKTFEQVKA IFLHPEPFSI
    660 670 680
    ENGLLTPTLK AKRGELSKYF RTQIDSLYEH IQD
    Note: Localize in mitochondrion and endoplasmic reticulum.
    Length:683
    Mass (Da):75,991
    Last modified:May 1, 2000 - v1
    <p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i781AFE1A7A78C286
    GO
    Isoform 2 (identifier: Q9ULC5-3) [UniParc]FASTAAdd to basket
    Also known as: ACSL5a

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MDALKPPCLWRNHERGKKDRDSCGRKNSEPGSPHSLEALRDAAPSQGLNFLLLFTKM

    Show »
    Length:739
    Mass (Da):82,263
    Checksum:iC3A1ABCA53717BCE
    GO
    Isoform 3 (identifier: Q9ULC5-4) [UniParc]FASTAAdd to basket
    Also known as: ACSL5delta20

    The sequence of this isoform differs from the canonical sequence as follows:
         614-637: Missing.

    Note: Localize in mitochondrion and endoplasmic reticulum.
    Show »
    Length:659
    Mass (Da):73,278
    Checksum:i8FA678B997F35EF7
    GO

    <p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

    The sequence BAA85979 differs from that shown. Reason: Erroneous initiation.Curated
    The sequence BAA86054 differs from that shown. Reason: Erroneous gene model prediction.Curated

    Natural variant

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_022117182M → V. Corresponds to variant dbSNP:rs3736946Ensembl.1
    Natural variantiVAR_036377388K → R in a colorectal cancer sample; somatic mutation. 1 Publication1
    Natural variantiVAR_036378466G → D in a colorectal cancer sample; somatic mutation. 1 Publication1
    Natural variantiVAR_048240486T → A. Corresponds to variant dbSNP:rs12254915Ensembl.1

    Alternative sequence

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0379471M → MDALKPPCLWRNHERGKKDR DSCGRKNSEPGSPHSLEALR DAAPSQGLNFLLLFTKM in isoform 2. 3 Publications1
    Alternative sequenceiVSP_038233614 – 637Missing in isoform 3. 1 PublicationAdd BLAST24

    Sequence databases

    Select the link destinations:

    EMBL nucleotide sequence database

    More...
    EMBLi

    GenBank nucleotide sequence database

    More...
    GenBanki

    DNA Data Bank of Japan; a nucleotide sequence database

    More...
    DDBJi
    Links Updated
    AM262166 mRNA Translation: CAK18174.1
    AY358520 mRNA Translation: AAQ88884.1
    AK000339 mRNA No translation available.
    AK222782 mRNA No translation available.
    AL157786 Genomic DNA No translation available.
    CH471066 Genomic DNA Translation: EAW49532.1
    CH471066 Genomic DNA Translation: EAW49535.1
    CH471066 Genomic DNA Translation: EAW49536.1
    CH471066 Genomic DNA Translation: EAW49539.1
    BC007985 mRNA Translation: AAH07985.2
    AB033899 mRNA Translation: BAA85979.1 Different initiation.
    AB033920 Genomic DNA Translation: BAA86054.1 Sequence problems.

    The Consensus CDS (CCDS) project

    More...
    CCDSi
    CCDS7572.1 [Q9ULC5-3]
    CCDS7573.1 [Q9ULC5-1]

    NCBI Reference Sequences

    More...
    RefSeqi
    NP_057318.2, NM_016234.3 [Q9ULC5-3]
    NP_976313.1, NM_203379.1 [Q9ULC5-1]
    NP_976314.1, NM_203380.1 [Q9ULC5-1]

    Genome annotation databases

    Ensembl eukaryotic genome annotation project

    More...
    Ensembli
    ENST00000354273; ENSP00000346223; ENSG00000197142 [Q9ULC5-1]
    ENST00000354655; ENSP00000346680; ENSG00000197142 [Q9ULC5-1]
    ENST00000356116; ENSP00000348429; ENSG00000197142 [Q9ULC5-3]
    ENST00000393081; ENSP00000376796; ENSG00000197142 [Q9ULC5-1]
    ENST00000433418; ENSP00000403647; ENSG00000197142 [Q9ULC5-4]

    Database of genes from NCBI RefSeq genomes

    More...
    GeneIDi
    51703

    KEGG: Kyoto Encyclopedia of Genes and Genomes

    More...
    KEGGi
    hsa:51703

    UCSC genome browser

    More...
    UCSCi
    uc001kzs.4 human [Q9ULC5-1]

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    <p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

    <p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBLi
    GenBanki
    DDBJi
    Links Updated
    AM262166 mRNA Translation: CAK18174.1
    AY358520 mRNA Translation: AAQ88884.1
    AK000339 mRNA No translation available.
    AK222782 mRNA No translation available.
    AL157786 Genomic DNA No translation available.
    CH471066 Genomic DNA Translation: EAW49532.1
    CH471066 Genomic DNA Translation: EAW49535.1
    CH471066 Genomic DNA Translation: EAW49536.1
    CH471066 Genomic DNA Translation: EAW49539.1
    BC007985 mRNA Translation: AAH07985.2
    AB033899 mRNA Translation: BAA85979.1 Different initiation.
    AB033920 Genomic DNA Translation: BAA86054.1 Sequence problems.
    CCDSiCCDS7572.1 [Q9ULC5-3]
    CCDS7573.1 [Q9ULC5-1]
    RefSeqiNP_057318.2, NM_016234.3 [Q9ULC5-3]
    NP_976313.1, NM_203379.1 [Q9ULC5-1]
    NP_976314.1, NM_203380.1 [Q9ULC5-1]

    3D structure databases

    SMRiQ9ULC5
    ModBaseiSearch...

    Protein-protein interaction databases

    BioGridi119687, 7 interactors
    IntActiQ9ULC5, 19 interactors
    MINTiQ9ULC5
    STRINGi9606.ENSP00000348429

    Chemistry databases

    ChEMBLiCHEMBL4105818
    SwissLipidsiSLP:000000202
    SLP:000000517 [Q9ULC5-3]
    SLP:000000518 [Q9ULC5-1]

    PTM databases

    iPTMnetiQ9ULC5
    PhosphoSitePlusiQ9ULC5
    SwissPalmiQ9ULC5

    Polymorphism and mutation databases

    BioMutaiACSL5
    DMDMi13431659

    Proteomic databases

    EPDiQ9ULC5
    jPOSTiQ9ULC5
    MassIVEiQ9ULC5
    PaxDbiQ9ULC5
    PeptideAtlasiQ9ULC5
    PRIDEiQ9ULC5
    ProteomicsDBi84979 [Q9ULC5-1]
    84980 [Q9ULC5-3]
    84981 [Q9ULC5-4]

    Protocols and materials databases

    The DNASU plasmid repository

    More...
    DNASUi
    51703

    Genome annotation databases

    EnsembliENST00000354273; ENSP00000346223; ENSG00000197142 [Q9ULC5-1]
    ENST00000354655; ENSP00000346680; ENSG00000197142 [Q9ULC5-1]
    ENST00000356116; ENSP00000348429; ENSG00000197142 [Q9ULC5-3]
    ENST00000393081; ENSP00000376796; ENSG00000197142 [Q9ULC5-1]
    ENST00000433418; ENSP00000403647; ENSG00000197142 [Q9ULC5-4]
    GeneIDi51703
    KEGGihsa:51703
    UCSCiuc001kzs.4 human [Q9ULC5-1]

    Organism-specific databases

    Comparative Toxicogenomics Database

    More...
    CTDi
    51703
    DisGeNETi51703

    GeneCards: human genes, protein and diseases

    More...
    GeneCardsi
    ACSL5
    HGNCiHGNC:16526 ACSL5
    HPAiCAB035986
    CAB062546
    HPA007162
    MIMi605677 gene
    neXtProtiNX_Q9ULC5
    OpenTargetsiENSG00000197142
    PharmGKBiPA27969

    GenAtlas: human gene database

    More...
    GenAtlasi
    Search...

    Phylogenomic databases

    eggNOGiKOG1256 Eukaryota
    COG1022 LUCA
    GeneTreeiENSGT00940000156651
    HOGENOMiHOG000159459
    InParanoidiQ9ULC5
    KOiK01897
    OMAiAIWMAGH
    OrthoDBi947804at2759
    PhylomeDBiQ9ULC5
    TreeFamiTF313877

    Enzyme and pathway databases

    BioCyciMetaCyc:HS01349-MONOMER
    ReactomeiR-HSA-75876 Synthesis of very long-chain fatty acyl-CoAs
    SABIO-RKiQ9ULC5

    Miscellaneous databases

    ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

    More...
    ChiTaRSi
    ACSL5 human

    The Gene Wiki collection of pages on human genes and proteins

    More...
    GeneWikii
    ACSL5

    Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

    More...
    GenomeRNAii
    51703
    PharosiQ9ULC5

    Protein Ontology

    More...
    PROi
    PR:Q9ULC5

    The Stanford Online Universal Resource for Clones and ESTs

    More...
    SOURCEi
    Search...

    Gene expression databases

    BgeeiENSG00000197142 Expressed in 205 organ(s), highest expression level in jejunal mucosa
    GenevisibleiQ9ULC5 HS

    Family and domain databases

    Gene3Di3.40.50.12780, 2 hits
    InterProiView protein in InterPro
    IPR020845 AMP-binding_CS
    IPR000873 AMP-dep_Synth/Lig
    IPR042099 AMP-dep_Synthh-like_sf
    PfamiView protein in Pfam
    PF00501 AMP-binding, 1 hit
    PROSITEiView protein in PROSITE
    PS00455 AMP_BINDING, 1 hit

    ProtoNet; Automatic hierarchical classification of proteins

    More...
    ProtoNeti
    Search...

    MobiDB: a database of protein disorder and mobility annotations

    More...
    MobiDBi
    Search...

    <p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

    <p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiACSL5_HUMAN
    <p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9ULC5
    Secondary accession number(s): A6GV77
    , D3DRB3, Q6UX44, Q9UIU4
    <p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 27, 2001
    Last sequence update: May 1, 2000
    Last modified: November 13, 2019
    This is version 177 of the entry and version 1 of the sequence. See complete history.
    <p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    <p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 10
      Human chromosome 10: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. SIMILARITY comments
      Index of protein domains and families
    4. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    5. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    UniProt is an ELIXIR core data resource
    Main funding by: National Institutes of Health

    We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

    Do not show this banner again