Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
We will be switching to the new UniProt website soon. Please explore and share your feedback. Take me to the new website.

UniProtKB - Q9ULB1 (NRX1A_HUMAN)

Entry version 207 (23 Feb 2022)
Sequence version 1 (01 May 2000)
Previous versions | rss
Add a publicationFeedback
Protein

Neurexin-1

Gene

NRXN1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Cell surface protein involved in cell-cell-interactions, exocytosis of secretory granules and regulation of signal transmission. Function is isoform-specific. Alpha-type isoforms have a long N-terminus with six laminin G-like domains and play an important role in synaptic signal transmission. Alpha-type isoforms play a role in the regulation of calcium channel activity and Ca2+-triggered neurotransmitter release at synapses and at neuromuscular junctions. They play an important role in Ca2+-triggered exocytosis of secretory granules in pituitary gland. They may effect their functions at synapses and in endocrine cells via their interactions with proteins from the exocytotic machinery. Likewise, alpha-type isoforms play a role in regulating the activity of postsynaptic NMDA receptors, a subtype of glutamate-gated ion channels. Both alpha-type and beta-type isoforms may play a role in the formation or maintenance of synaptic junctions via their calcium-dependent interactions (via the extracellular domains) with neuroligin family members, CBLN1 or CBLN2. In vitro, triggers the de novo formation of presynaptic structures. May be involved in specification of excitatory synapses. Alpha-type isoforms were first identified as receptors for alpha-latrotoxin from spider venom (By similarity).

By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the 'Description' field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi329CalciumBy similarity1
Metal bindingi329Calcium 1By similarity1
Metal bindingi346Calcium 1; via carbonyl oxygenBy similarity1
Metal bindingi407Calcium 1; via carbonyl oxygenBy similarity1
Metal bindingi765Calcium 2By similarity1
Metal bindingi782Calcium 2; via carbonyl oxygenBy similarity1
Metal bindingi841Calcium 2; via carbonyl oxygenBy similarity1
Metal bindingi1176Calcium 3By similarity1
Metal bindingi1193Calcium 3; via carbonyl oxygenBy similarity1
Metal bindingi1245Calcium 3; via carbonyl oxygenBy similarity1
Metal bindingi1247Calcium 3By similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processCell adhesion
LigandCalcium, Metal-binding

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q9ULB1

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-3000171, Non-integrin membrane-ECM interactions
R-HSA-6794361, Neurexins and neuroligins

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...SignaLinki		Q9ULB1

SIGNOR Signaling Network Open Resource

More...SIGNORi		Q9ULB1

Protein family/group databases

Transport Classification Database

More...TCDBi		8.A.74.1.2, the tm9 or phg1 targeting receptor (ppg1) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Neurexin-1
Alternative name(s):
Neurexin I-alpha
Neurexin-1-alpha
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:NRXN1
Synonyms:KIAA0578
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:8008, NRXN1

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		600565, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q9ULB1

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000179915

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini31 – 1401ExtracellularSequence analysisAdd BLAST1371
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei1402 – 1422HelicalSequence analysisAdd BLAST21
Topological domaini1423 – 1477CytoplasmicSequence analysisAdd BLAST55

Keywords - Cellular componenti

Cell junction, Cell membrane, Cell projection, Membrane, Synapse

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Pitt-Hopkins-like syndrome 2 (PTHSL2)1 Publication
The disease is caused by variants affecting the gene represented in this entry.
Disease descriptionA syndrome characterized by severe mental retardation and variable additional symptoms, such as impaired speech development, autistic behavior, breathing anomalies and a broad mouth, resembling Pitt-Hopkins syndrome. Other features include decreased reflexes in the upper extremities, constipation, strabismus, and protruding tongue with drooling. In contrast to patients with Pitt-Hopkins syndrome, PTHSL2 patients present with normal or only mildly to moderately delayed motor milestones.
Related information in OMIM
Schizophrenia 17 (SCZD17)1 Publication
Disease susceptibility may be associated with variants affecting the gene represented in this entry.
Disease descriptionA complex, multifactorial psychotic disorder or group of disorders characterized by disturbances in the form and content of thought (e.g. delusions, hallucinations), in mood (e.g. inappropriate affect), in sense of self and relationship to the external world (e.g. loss of ego boundaries, withdrawal), and in behavior (e.g bizarre or apparently purposeless behavior). Although it affects emotions, it is distinguished from mood disorders in which such disturbances are primary. Similarly, there may be mild impairment of cognitive function, and it is distinguished from the dementias in which disturbed cognitive function is considered primary. Some patients manifest schizophrenic as well as bipolar disorder symptoms and are often given the diagnosis of schizoaffective disorder.
Related information in OMIM

Keywords - Diseasei

Mental retardation, Schizophrenia

Organism-specific databases

DisGeNET

More...DisGeNETi		9378

MalaCards human disease database

More...MalaCardsi		NRXN1
MIMi614325, phenotype
614332, phenotype

Open Targets

More...OpenTargetsi		ENSG00000179915

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...Orphaneti		106, NON RARE IN EUROPE: Autism
600663, NRXN1-related severe neurodevelopmental disorder-motor stereotypies-chronic constipation-sleep-wake cycle disturbance

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA31786

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q9ULB1, Tbio

Chemistry databases

Drug and drug target database

More...DrugBanki		DB11093, Calcium citrate
DB11348, Calcium Phosphate
DB14481, Calcium phosphate dihydrate

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		NRXN1

Domain mapping of disease mutations (DMDM)

More...DMDMi		17369704

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 30By similarityAdd BLAST30
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000001949031 – 1477Neurexin-1Add BLAST1447

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi125N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi190N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi228 ↔ 243By similarity
Disulfide bondi245 ↔ 255By similarity
Disulfide bondi437 ↔ 473By similarity
Disulfide bondi643 ↔ 672By similarity
Disulfide bondi680 ↔ 691By similarity
Disulfide bondi685 ↔ 700By similarity
Disulfide bondi702 ↔ 712By similarity
Glycosylationi790N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi1052 ↔ 1080By similarity
Disulfide bondi1087 ↔ 1098By similarity
Disulfide bondi1092 ↔ 1107By similarity
Disulfide bondi1109 ↔ 1119By similarity
Glycosylationi1223N-linked (GlcNAc...) asparagineSequence analysis1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

N-glycosylated.By similarity
O-glycosylated.By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q9ULB1

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q9ULB1

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q9ULB1

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q9ULB1

PeptideAtlas

More...PeptideAtlasi		Q9ULB1

PRoteomics IDEntifications database

More...PRIDEi		Q9ULB1

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		84967 [Q9ULB1-1]
84968 [Q9ULB1-2]
84969 [Q9ULB1-3]

PTM databases

GlyConnect protein glycosylation platform

More...GlyConnecti		1548, 1 N-Linked glycan (1 site)

GlyGen: Computational and Informatics Resources for Glycoscience

More...GlyGeni		Q9ULB1, 4 sites, 1 N-linked glycan (1 site)

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q9ULB1

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q9ULB1

SwissPalm database of S-palmitoylation events

More...SwissPalmi		Q9ULB1

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Brain.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000179915, Expressed in corpus callosum and 196 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q9ULB1, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q9ULB1, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000179915, Tissue enriched (brain)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts (via laminin G-like domain 2 and/or laminin G-like domain 6) with NLGN1 forming a heterotetramer, where one NLGN1 dimer interacts with one NRXN1 dimer (By similarity).

Interacts (via cytoplasmic C-terminal region) with CASK (via the PDZ, SH3 and guanylate kinase-like domains) (By similarity).

Interacts (via cytoplasmic C-terminus) with CASKIN1 and APBA1 (By similarity).

Interacts (via laminin G-like domain 2 and/or laminin G-like domain 6) with NLGN1, NLGN2, NLGN3, NLGN4X and NLGN4Y; these interactions are calcium-dependent.

Interacts (via laminin G-like domain 2) with NXPH1 and NXPH3.

Interacts with CBLN1, CBLN2 and, less avidly, with CBLN4 (By similarity).

Interacts with LRRTM1, LRRTM2, LRRTM3 and LRRTM4 (By similarity). Alpha-type isoforms (neurexin-1-alpha) interact (via laminin G-like domain 2 and/or laminin G-like domain 6) with DAG1 (via alpha-dystroglycan chain). Alpha-type isoforms interact with alpha-latrotoxin from spider venom.

Interacts with SYT13 and SYTL1 (By similarity).

By similarity

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		114779, 16 interactors

CORUM comprehensive resource of mammalian protein complexes

More...CORUMi		Q9ULB1

Protein interaction database and analysis system

More...IntActi		Q9ULB1, 6 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000385142

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q9ULB1, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

11477
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Small Angle Scattering Biological Data Bank

More...SASBDBi		Q9ULB1

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q9ULB1

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini31 – 217Laminin G-like 1PROSITE-ProRule annotationAdd BLAST187
Domaini213 – 256EGF-like 1PROSITE-ProRule annotationAdd BLAST44
Domaini283 – 473Laminin G-like 2PROSITE-ProRule annotationAdd BLAST191
Domaini480 – 672Laminin G-like 3PROSITE-ProRule annotationAdd BLAST193
Domaini676 – 713EGF-like 2PROSITE-ProRule annotationAdd BLAST38
Domaini718 – 891Laminin G-like 4PROSITE-ProRule annotationAdd BLAST174
Domaini905 – 1080Laminin G-like 5PROSITE-ProRule annotationAdd BLAST176
Domaini1083 – 1120EGF-like 3PROSITE-ProRule annotationAdd BLAST38
Domaini1126 – 1294Laminin G-like 6PROSITE-ProRule annotationAdd BLAST169

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni198 – 221DisorderedSequence analysisAdd BLAST24
Regioni1325 – 1390DisorderedSequence analysisAdd BLAST66
Regioni1444 – 1477DisorderedSequence analysisAdd BLAST34
Regioni1444 – 1470Interaction with CASKBy similarityAdd BLAST27

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi1444 – 1460Polar residuesSequence analysisAdd BLAST17
Compositional biasi1461 – 1477Basic and acidic residuesSequence analysisAdd BLAST17

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the neurexin family.Curated

Keywords - Domaini

EGF-like domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG3514, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000154292

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_001710_0_1_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q9ULB1

Identification of Orthologs from Complete Genome Data

More...OMAi		LMMGDQX

Database of Orthologous Groups

More...OrthoDBi		35129at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q9ULB1

TreeFam database of animal gene trees

More...TreeFami		TF321302

Family and domain databases

Conserved Domains Database

More...CDDi		cd00110, LamG, 6 hits

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR013320, ConA-like_dom_sf
IPR000742, EGF-like_dom
IPR000152, EGF-type_Asp/Asn_hydroxyl_site
IPR001791, Laminin_G
IPR003585, Neurexin-like
IPR027789, Syndecan/Neurexin_dom

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00008, EGF, 1 hit
PF02210, Laminin_G_2, 6 hits
PF01034, Syndecan, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00294, 4.1m, 1 hit
SM00181, EGF, 3 hits
SM00282, LamG, 6 hits

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF49899, SSF49899, 6 hits

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS00010, ASX_HYDROXYL, 1 hit
PS50026, EGF_3, 3 hits
PS50025, LAM_G_DOMAIN, 6 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 6 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative promoter usage and alternative splicing. AlignAdd to basket
Note: A number of isoforms are produced by alternative promoter usage including the alpha-type and beta-type isoforms which differ in their N-terminus. Additional isoforms may be produced by alternative splicing.2 Publications

This entry has 6 described isoforms and 25 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1a (identifier: Q9ULB1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <p><strong>What is the canonical sequence?</strong><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGTALLQRGG CFLLCLSLLL LGCWAELGSG LEFPGAEGQW TRFPKWNACC 
        60         70         80         90        100
ESEMSFQLKT RSARGLVLYF DDEGFCDFLE LILTRGGRLQ LSFSIFCAEP 
       110        120        130        140        150
ATLLADTPVN DGAWHSVRIR RQFRNTTLFI DQVEAKWVEV KSKRRDMTVF 
       160        170        180        190        200
SGLFVGGLPP ELRAAALKLT LASVREREPF KGWIRDVRVN SSQVLPVDSG 
       210        220        230        240        250
EVKLDDEPPN SGGGSPCEAG EEGEGGVCLN GGVCSVVDDQ AVCDCSRTGF 
       260        270        280        290        300
RGKDCSQEDN NVEGLAHLMM GDQGKSKGKE EYIATFKGSE YFCYDLSQNP 
       310        320        330        340        350
IQSSSDEITL SFKTLQRNGL MLHTGKSADY VNLALKNGAV SLVINLGSGA 
       360        370        380        390        400
FEALVEPVNG KFNDNAWHDV KVTRNLRQHS GIGHAMVTIS VDGILTTTGY 
       410        420        430        440        450
TQEDYTMLGS DDFFYVGGSP STADLPGSPV SNNFMGCLKE VVYKNNDVRL 
       460        470        480        490        500
ELSRLAKQGD PKMKIHGVVA FKCENVATLD PITFETPESF ISLPKWNAKK 
       510        520        530        540        550
TGSISFDFRT TEPNGLILFS HGKPRHQKDA KHPQMIKVDF FAIEMLDGHL 
       560        570        580        590        600
YLLLDMGSGT IKIKALLKKV NDGEWYHVDF QRDGRSGTIS VNTLRTPYTA 
       610        620        630        640        650
PGESEILDLD DELYLGGLPE NKAGLVFPTE VWTALLNYGY VGCIRDLFID 
       660        670        680        690        700
GQSKDIRQMA EVQSTAGVKP SCSKETAKPC LSNPCKNNGM CRDGWNRYVC 
       710        720        730        740        750
DCSGTGYLGR SCEREATVLS YDGSMFMKIQ LPVVMHTEAE DVSLRFRSQR 
       760        770        780        790        800
AYGILMATTS RDSADTLRLE LDAGRVKLTV NLDCIRINCN SSKGPETLFA 
       810        820        830        840        850
GYNLNDNEWH TVRVVRRGKS LKLTVDDQQA MTGQMAGDHT RLEFHNIETG 
       860        870        880        890        900
IITERRYLSS VPSNFIGHLQ SLTFNGMAYI DLCKNGDIDY CELNARFGFR 
       910        920        930        940        950
NIIADPVTFK TKSSYVALAT LQAYTSMHLF FQFKTTSLDG LILYNSGDGN 
       960        970        980        990       1000
DFIVVELVKG YLHYVFDLGN GANLIKGSSN KPLNDNQWHN VMISRDTSNL 
      1010       1020       1030       1040       1050
HTVKIDTKIT TQITAGARNL DLKSDLYIGG VAKETYKSLP KLVHAKEGFQ 
      1060       1070       1080       1090       1100
GCLASVDLNG RLPDLISDAL FCNGQIERGC EGPSTTCQED SCSNQGVCLQ 
      1110       1120       1130       1140       1150
QWDGFSCDCS MTSFSGPLCN DPGTTYIFSK GGGQITYKWP PNDRPSTRAD 
      1160       1170       1180       1190       1200
RLAIGFSTVQ KEAVLVRVDS SSGLGDYLEL HIHQGKIGVK FNVGTDDIAI 
      1210       1220       1230       1240       1250
EESNAIINDG KYHVVRFTRS GGNATLQVDS WPVIERYPAG RQLTIFNSQA 
      1260       1270       1280       1290       1300
TIIIGGKEQG QPFQGQLSGL YYNGLKVLNM AAENDANIAI VGNVRLVGEV 
      1310       1320       1330       1340       1350
PSSMTTESTA TAMQSEMSTS IMETTTTLAT STARRGKPPT KEPISQTTDD 
      1360       1370       1380       1390       1400
ILVASAECPS DDEDIDPCEP SSGGLANPTR AGGREPYPGS AEVIRESSST 
      1410       1420       1430       1440       1450
TGMVVGIVAA AALCILILLY AMYKYRNRDE GSYHVDESRN YISNSAQSNG 
      1460       1470 
AVVKEKQPSS AKSSNKNKKN KDKEYYV
Length:1,477
Mass (Da):161,883
Last modified:May 1, 2000 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iFF845FB428B1A683
GO
Isoform 2a (identifier: Q9ULB1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     379-386: Missing.
     1239-1239: A → AGNNDNERLAIARQRIPYRLGRVVDEWLLDK
     1373-1375: Missing.

Note: Produced by alternative splicing.Curated
Show »
Length:1,496
Mass (Da):164,428
Checksum:i8A9B5DA4D7783F9D
GO
Isoform 3a (identifier: Q9ULB1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     258-258: E → EIKFGLQCVLPVLLHDNDQGKYCCINTAKPLTEK
     386-386: M → MVNKLHCS
     1239-1239: A → AGNNDNERLAIARQRIPYRLGRVVDEWLLDK

Note: Produced by alternative splicing.Curated
Show »
Length:1,547
Mass (Da):169,913
Checksum:i2F6A3FBB6E53AA2E
GO
Isoform 3b (identifier: P58400-1) [UniParc]FASTAAdd to basket
The sequence of this isoform can be found in the external entry P58400.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
Length:442
Mass (Da):46,861
GO
Isoform 4 (identifier: Q9ULB1-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1335: Missing.
     1336-1344: GKPPTKEPI → MDMRWHCEN
     1373-1375: Missing.

Note: Produced by alternative promoter usage and alternative splicing.Curated
Show »
Length:139
Mass (Da):15,277
Checksum:iCB02C9A82E954D7F
GO
Isoform 1b (identifier: P58400-2) [UniParc]FASTAAdd to basket
The sequence of this isoform can be found in the external entry P58400.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
Length:472
Mass (Da):50,424
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 25 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E7ERL8E7ERL8_HUMAN
Neurexin-1-beta
NRXN1
1,507Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1D5RMU6A0A1D5RMU6_HUMAN
Neurexin-1-beta
NRXN1
1,499Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0R4J2G7A0A0R4J2G7_HUMAN
Neurexin-1-beta
NRXN1
1,495Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0D9SEM5A0A0D9SEM5_HUMAN
Neurexin-1-beta
NRXN1
469Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0D9SF36A0A0D9SF36_HUMAN
Neurexin-1-beta
NRXN1
213Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0Y568H0Y568_HUMAN
Neurexin-1-beta
NRXN1
139Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7BYC7H7BYC7_HUMAN
Neurexin-1-beta
NRXN1
142Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q08AH0Q08AH0_HUMAN
NRXN1 protein
NRXN1
198Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1B0GTL0A0A1B0GTL0_HUMAN
Neurexin-1-beta
NRXN1
143Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E7EQN4E7EQN4_HUMAN
Neurexin-1-beta
NRXN1
278Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There are more potential isoformsShow all

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAA25504 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti1360S → G in CAI46085 (PubMed:11230166).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_07027428G → A1 PublicationCorresponds to variant dbSNP:rs199598542EnsemblClinVar.1
Natural variantiVAR_050265400Y → N. Corresponds to variant dbSNP:rs17040901Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0582001 – 1335Missing in isoform 4. 1 PublicationAdd BLAST1335
Alternative sequenceiVSP_041353258E → EIKFGLQCVLPVLLHDNDQG KYCCINTAKPLTEK in isoform 3a. 1 Publication1
Alternative sequenceiVSP_014541379 – 386Missing in isoform 2a. 1 Publication8
Alternative sequenceiVSP_041354386M → MVNKLHCS in isoform 3a. 1 Publication1
Alternative sequenceiVSP_0413551239A → AGNNDNERLAIARQRIPYRL GRVVDEWLLDK in isoform 3a and isoform 2a. 2 Publications1
Alternative sequenceiVSP_0582011336 – 1344GKPPTKEPI → MDMRWHCEN in isoform 4. 1 Publication9
Alternative sequenceiVSP_0582021373 – 1375Missing in isoform 4 and isoform 2a. 2 Publications3

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
EF539882 mRNA Translation: ABS86974.1
AB035356 mRNA Translation: BAA87821.1
AB011150 mRNA Translation: BAA25504.2 Different initiation.
BX647616 mRNA Translation: CAI46085.1
AC007462 Genomic DNA Translation: AAF03536.1
AC007682 Genomic DNA Translation: AAY14894.1
AC009234 Genomic DNA Translation: AAY14944.1
AC068725 Genomic DNA Translation: AAG59602.1
AC069550 Genomic DNA Translation: AAG38120.1
AC078994 Genomic DNA Translation: AAK06387.1
AC068715 Genomic DNA Translation: AAG59642.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS46282.1 [Q9ULB1-3]
CCDS54360.1 [Q9ULB1-1]
CCDS82445.1 [Q9ULB1-4]
CCDS82450.1 [Q9ULB1-2]

NCBI Reference Sequences

More...RefSeqi		NP_001129131.1, NM_001135659.2 [Q9ULB1-3]
NP_001317011.1, NM_001330082.1 [Q9ULB1-2]
NP_004792.1, NM_004801.5 [Q9ULB1-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000404971; ENSP00000385142; ENSG00000179915 [Q9ULB1-3]
ENST00000406316; ENSP00000384311; ENSG00000179915
ENST00000625672; ENSP00000485887; ENSG00000179915 [Q9ULB1-2]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		9378

UCSC genome browser

More...UCSCi		uc061jbb.1, human [Q9ULB1-1]

Keywords - Coding sequence diversityi

Alternative promoter usage, Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
EF539882 mRNA Translation: ABS86974.1
AB035356 mRNA Translation: BAA87821.1
AB011150 mRNA Translation: BAA25504.2 Different initiation.
BX647616 mRNA Translation: CAI46085.1
AC007462 Genomic DNA Translation: AAF03536.1
AC007682 Genomic DNA Translation: AAY14894.1
AC009234 Genomic DNA Translation: AAY14944.1
AC068725 Genomic DNA Translation: AAG59602.1
AC069550 Genomic DNA Translation: AAG38120.1
AC078994 Genomic DNA Translation: AAK06387.1
AC068715 Genomic DNA Translation: AAG59642.1
CCDSiCCDS46282.1 [Q9ULB1-3]
CCDS54360.1 [Q9ULB1-1]
CCDS82445.1 [Q9ULB1-4]
CCDS82450.1 [Q9ULB1-2]
RefSeqiNP_001129131.1, NM_001135659.2 [Q9ULB1-3]
NP_001317011.1, NM_001330082.1 [Q9ULB1-2]
NP_004792.1, NM_004801.5 [Q9ULB1-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
6NIDX-ray1.86D/E/F1468-1477[»]
SASBDBiQ9ULB1
SMRiQ9ULB1
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi114779, 16 interactors
CORUMiQ9ULB1
IntActiQ9ULB1, 6 interactors
STRINGi9606.ENSP00000385142

Chemistry databases

DrugBankiDB11093, Calcium citrate
DB11348, Calcium Phosphate
DB14481, Calcium phosphate dihydrate

Protein family/group databases

TCDBi8.A.74.1.2, the tm9 or phg1 targeting receptor (ppg1) family

PTM databases

GlyConnecti1548, 1 N-Linked glycan (1 site)
GlyGeniQ9ULB1, 4 sites, 1 N-linked glycan (1 site)
iPTMnetiQ9ULB1
PhosphoSitePlusiQ9ULB1
SwissPalmiQ9ULB1

Genetic variation databases

BioMutaiNRXN1
DMDMi17369704

Proteomic databases

EPDiQ9ULB1
MassIVEiQ9ULB1
MaxQBiQ9ULB1
PaxDbiQ9ULB1
PeptideAtlasiQ9ULB1
PRIDEiQ9ULB1
ProteomicsDBi84967 [Q9ULB1-1]
84968 [Q9ULB1-2]
84969 [Q9ULB1-3]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		30173, 295 antibodies from 37 providers

The DNASU plasmid repository

More...DNASUi		9378

Genome annotation databases

EnsembliENST00000404971; ENSP00000385142; ENSG00000179915 [Q9ULB1-3]
ENST00000406316; ENSP00000384311; ENSG00000179915
ENST00000625672; ENSP00000485887; ENSG00000179915 [Q9ULB1-2]
GeneIDi9378
UCSCiuc061jbb.1, human [Q9ULB1-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		9378
DisGeNETi9378

GeneCards: human genes, protein and diseases

More...GeneCardsi		NRXN1
HGNCiHGNC:8008, NRXN1
HPAiENSG00000179915, Tissue enriched (brain)
MalaCardsiNRXN1
MIMi600565, gene
614325, phenotype
614332, phenotype
neXtProtiNX_Q9ULB1
OpenTargetsiENSG00000179915
Orphaneti106, NON RARE IN EUROPE: Autism
600663, NRXN1-related severe neurodevelopmental disorder-motor stereotypies-chronic constipation-sleep-wake cycle disturbance
PharmGKBiPA31786
VEuPathDBiHostDB:ENSG00000179915

Human Unidentified Gene-Encoded large proteins database

More...HUGEi		Search...

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG3514, Eukaryota
GeneTreeiENSGT00940000154292
HOGENOMiCLU_001710_0_1_1
InParanoidiQ9ULB1
OMAiLMMGDQX
OrthoDBi35129at2759
PhylomeDBiQ9ULB1
TreeFamiTF321302

Enzyme and pathway databases

PathwayCommonsiQ9ULB1
ReactomeiR-HSA-3000171, Non-integrin membrane-ECM interactions
R-HSA-6794361, Neurexins and neuroligins
SignaLinkiQ9ULB1
SIGNORiQ9ULB1

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		9378, 2 hits in 1029 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		NRXN1, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		9378
PharosiQ9ULB1, Tbio
RNActiQ9ULB1, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000179915, Expressed in corpus callosum and 196 other tissues
ExpressionAtlasiQ9ULB1, baseline and differential
GenevisibleiQ9ULB1, HS

Family and domain databases

CDDicd00110, LamG, 6 hits
InterProiView protein in InterPro
IPR013320, ConA-like_dom_sf
IPR000742, EGF-like_dom
IPR000152, EGF-type_Asp/Asn_hydroxyl_site
IPR001791, Laminin_G
IPR003585, Neurexin-like
IPR027789, Syndecan/Neurexin_dom
PfamiView protein in Pfam
PF00008, EGF, 1 hit
PF02210, Laminin_G_2, 6 hits
PF01034, Syndecan, 1 hit
SMARTiView protein in SMART
SM00294, 4.1m, 1 hit
SM00181, EGF, 3 hits
SM00282, LamG, 6 hits
SUPFAMiSSF49899, SSF49899, 6 hits
PROSITEiView protein in PROSITE
PS00010, ASX_HYDROXYL, 1 hit
PS50026, EGF_3, 3 hits
PS50025, LAM_G_DOMAIN, 6 hits

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiNRX1A_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9ULB1
Secondary accession number(s): A7KRL9
, O60323, Q53TJ9, Q53TQ1, Q5HYI0, Q9C079, Q9C080, Q9C081, Q9H3M2, Q9UDM6
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 16, 2001
Last sequence update: May 1, 2000
Last modified: February 23, 2022
This is version 207 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again