Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 194 (16 Oct 2019)
Sequence version 1 (01 May 2000)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Neurexin-1

Gene

NRXN1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Cell surface protein involved in cell-cell-interactions, exocytosis of secretory granules and regulation of signal transmission. Function is isoform-specific. Alpha-type isoforms have a long N-terminus with six laminin G-like domains and play an important role in synaptic signal transmission. Alpha-type isoforms play a role in the regulation of calcium channel activity and Ca2+-triggered neurotransmitter release at synapses and at neuromuscular junctions. They play an important role in Ca2+-triggered exocytosis of secretory granules in pituitary gland. They may effect their functions at synapses and in endocrine cells via their interactions with proteins from the exocytotic machinery. Likewise, alpha-type isoforms play a role in regulating the activity of postsynaptic NMDA receptors, a subtype of glutamate-gated ion channels. Both alpha-type and beta-type isoforms may play a role in the formation or maintenance of synaptic junctions via their calcium-dependent interactions (via the extracellular domains) with neuroligin family members, CBLN1 or CBLN2. In vitro, triggers the de novo formation of presynaptic structures. May be involved in specification of excitatory synapses. Alpha-type isoforms were first identified as receptors for alpha-latrotoxin from spider venom (By similarity).By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the ‘Description’ field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi329CalciumBy similarity1
Metal bindingi329Calcium 1By similarity1
Metal bindingi346Calcium 1; via carbonyl oxygenBy similarity1
Metal bindingi407Calcium 1; via carbonyl oxygenBy similarity1
Metal bindingi765Calcium 2By similarity1
Metal bindingi782Calcium 2; via carbonyl oxygenBy similarity1
Metal bindingi841Calcium 2; via carbonyl oxygenBy similarity1
Metal bindingi1176Calcium 3By similarity1
Metal bindingi1193Calcium 3; via carbonyl oxygenBy similarity1
Metal bindingi1245Calcium 3; via carbonyl oxygenBy similarity1
Metal bindingi1247Calcium 3By similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processCell adhesion
LigandCalcium, Metal-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-3000171 Non-integrin membrane-ECM interactions
R-HSA-6794361 Neurexins and neuroligins

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q9ULB1

Protein family/group databases

Transport Classification Database

More...
TCDBi
8.A.74.1.2 the tm9 or phg1 targeting receptor (ppg1) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Neurexin-1
Alternative name(s):
Neurexin I-alpha
Neurexin-1-alpha
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:NRXN1
Synonyms:KIAA0578
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:8008 NRXN1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
600565 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9ULB1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini31 – 1401ExtracellularSequence analysisAdd BLAST1371
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei1402 – 1422HelicalSequence analysisAdd BLAST21
Topological domaini1423 – 1477CytoplasmicSequence analysisAdd BLAST55

Keywords - Cellular componenti

Cell junction, Cell membrane, Cell projection, Membrane, Synapse

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Pitt-Hopkins-like syndrome 2 (PTHSL2)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA syndrome characterized by severe mental retardation and variable additional symptoms, such as impaired speech development, autistic behavior, breathing anomalies and a broad mouth, resembling Pitt-Hopkins syndrome. Other features include decreased reflexes in the upper extremities, constipation, strabismus, and protruding tongue with drooling. In contrast to patients with Pitt-Hopkins syndrome, PTHSL2 patients present with normal or only mildly to moderately delayed motor milestones.
Related information in OMIM
Schizophrenia 17 (SCZD17)1 Publication
Disease susceptibility may be associated with variations affecting the gene represented in this entry.
Disease descriptionA complex, multifactorial psychotic disorder or group of disorders characterized by disturbances in the form and content of thought (e.g. delusions, hallucinations), in mood (e.g. inappropriate affect), in sense of self and relationship to the external world (e.g. loss of ego boundaries, withdrawal), and in behavior (e.g bizarre or apparently purposeless behavior). Although it affects emotions, it is distinguished from mood disorders in which such disturbances are primary. Similarly, there may be mild impairment of cognitive function, and it is distinguished from the dementias in which disturbed cognitive function is considered primary. Some patients manifest schizophrenic as well as bipolar disorder symptoms and are often given the diagnosis of schizoaffective disorder.
Related information in OMIM

Keywords - Diseasei

Mental retardation, Schizophrenia

Organism-specific databases

DisGeNET

More...
DisGeNETi
9378

MalaCards human disease database

More...
MalaCardsi
NRXN1
MIMi614325 phenotype
614332 phenotype

Open Targets

More...
OpenTargetsi
ENSG00000179915

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
106 NON RARE IN EUROPE: Autism
221150 Pitt-Hopkins-like syndrome

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA31786

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q9ULB1

Chemistry databases

Drug and drug target database

More...
DrugBanki
DB11093 Calcium Citrate
DB11348 Calcium Phosphate
DB14481 Calcium phosphate dihydrate

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
NRXN1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
17369704

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 30By similarityAdd BLAST30
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000001949031 – 1477Neurexin-1Add BLAST1447

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi125N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi190N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi228 ↔ 243By similarity
Disulfide bondi245 ↔ 255By similarity
Disulfide bondi437 ↔ 473By similarity
Disulfide bondi643 ↔ 672By similarity
Disulfide bondi680 ↔ 691By similarity
Disulfide bondi685 ↔ 700By similarity
Disulfide bondi702 ↔ 712By similarity
Glycosylationi790N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi1052 ↔ 1080By similarity
Disulfide bondi1087 ↔ 1098By similarity
Disulfide bondi1092 ↔ 1107By similarity
Disulfide bondi1109 ↔ 1119By similarity
Glycosylationi1223N-linked (GlcNAc...) asparagineSequence analysis1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

N-glycosylated.By similarity
O-glycosylated.By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9ULB1

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q9ULB1

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q9ULB1

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9ULB1

PeptideAtlas

More...
PeptideAtlasi
Q9ULB1

PRoteomics IDEntifications database

More...
PRIDEi
Q9ULB1

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
84967 [Q9ULB1-1]
84968 [Q9ULB1-2]
84969 [Q9ULB1-3]

PTM databases

GlyConnect protein glycosylation platform

More...
GlyConnecti
1548

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9ULB1

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9ULB1

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q9ULB1

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Brain.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000179915 Expressed in 176 organ(s), highest expression level in corpus callosum

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9ULB1 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9ULB1 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA071400

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts (via laminin G-like domain 2 and/or laminin G-like domain 6) with NLGN1 forming a heterotetramer, where one NLGN1 dimer interacts with one NRXN1 dimer (By similarity).

Interacts (via cytoplasmic C-terminal region) with CASK (via the PDZ, SH3 and guanylate kinase-like domains) (By similarity).

Interacts (via cytoplasmic C-terminus) with CASKIN1 and APBA1 (By similarity).

Interacts (via laminin G-like domain 2 and/or laminin G-like domain 6) with NLGN1, NLGN2, NLGN3, NLGN4X and NLGN4Y; these interactions are calcium-dependent.

Interacts (via laminin G-like domain 2) with NXPH1 and NXPH3.

Interacts with CBLN1, CBLN2 and, less avidly, with CBLN4 (By similarity).

Interacts with LRRTM1, LRRTM2, LRRTM3 and LRRTM4 (By similarity). Alpha-type isoforms (neurexin-1-alpha) interact (via laminin G-like domain 2 and/or laminin G-like domain 6) with DAG1 (via alpha-dystroglycan chain). Alpha-type isoforms interact with alpha-latrotoxin from spider venom.

Interacts with SYT13 and SYTL1 (By similarity).

By similarity

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
114779, 15 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q9ULB1

Protein interaction database and analysis system

More...
IntActi
Q9ULB1, 6 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000385142

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9ULB1

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini31 – 217Laminin G-like 1PROSITE-ProRule annotationAdd BLAST187
Domaini213 – 256EGF-like 1PROSITE-ProRule annotationAdd BLAST44
Domaini283 – 473Laminin G-like 2PROSITE-ProRule annotationAdd BLAST191
Domaini480 – 672Laminin G-like 3PROSITE-ProRule annotationAdd BLAST193
Domaini676 – 713EGF-like 2PROSITE-ProRule annotationAdd BLAST38
Domaini718 – 891Laminin G-like 4PROSITE-ProRule annotationAdd BLAST174
Domaini905 – 1080Laminin G-like 5PROSITE-ProRule annotationAdd BLAST176
Domaini1083 – 1120EGF-like 3PROSITE-ProRule annotationAdd BLAST38
Domaini1126 – 1294Laminin G-like 6PROSITE-ProRule annotationAdd BLAST169

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1444 – 1470Interaction with CASKBy similarityAdd BLAST27

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi1324 – 1327Poly-Thr4
Compositional biasi1409 – 1412Poly-Ala4

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the neurexin family.Curated

Keywords - Domaini

EGF-like domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3514 Eukaryota
ENOG410XNU6 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000154292

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9ULB1

Identification of Orthologs from Complete Genome Data

More...
OMAi
LMMGDQX

Database of Orthologous Groups

More...
OrthoDBi
35129at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9ULB1

TreeFam database of animal gene trees

More...
TreeFami
TF321302

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR013320 ConA-like_dom_sf
IPR000742 EGF-like_dom
IPR000152 EGF-type_Asp/Asn_hydroxyl_site
IPR001791 Laminin_G
IPR003585 Neurexin-like
IPR027789 Syndecan/Neurexin_dom

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00008 EGF, 1 hit
PF02210 Laminin_G_2, 6 hits
PF01034 Syndecan, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00294 4.1m, 1 hit
SM00181 EGF, 3 hits
SM00282 LamG, 6 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF49899 SSF49899, 6 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00010 ASX_HYDROXYL, 1 hit
PS50026 EGF_3, 3 hits
PS50025 LAM_G_DOMAIN, 6 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 6 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative promoter usage and alternative splicing. AlignAdd to basket
Note: A number of isoforms are produced by alternative promoter usage including the alpha-type and beta-type isoforms which differ in their N-terminus. Additional isoforms may be produced by alternative splicing.2 Publications

This entry has 6 described isoforms and 26 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1a (identifier: Q9ULB1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGTALLQRGG CFLLCLSLLL LGCWAELGSG LEFPGAEGQW TRFPKWNACC
60 70 80 90 100
ESEMSFQLKT RSARGLVLYF DDEGFCDFLE LILTRGGRLQ LSFSIFCAEP
110 120 130 140 150
ATLLADTPVN DGAWHSVRIR RQFRNTTLFI DQVEAKWVEV KSKRRDMTVF
160 170 180 190 200
SGLFVGGLPP ELRAAALKLT LASVREREPF KGWIRDVRVN SSQVLPVDSG
210 220 230 240 250
EVKLDDEPPN SGGGSPCEAG EEGEGGVCLN GGVCSVVDDQ AVCDCSRTGF
260 270 280 290 300
RGKDCSQEDN NVEGLAHLMM GDQGKSKGKE EYIATFKGSE YFCYDLSQNP
310 320 330 340 350
IQSSSDEITL SFKTLQRNGL MLHTGKSADY VNLALKNGAV SLVINLGSGA
360 370 380 390 400
FEALVEPVNG KFNDNAWHDV KVTRNLRQHS GIGHAMVTIS VDGILTTTGY
410 420 430 440 450
TQEDYTMLGS DDFFYVGGSP STADLPGSPV SNNFMGCLKE VVYKNNDVRL
460 470 480 490 500
ELSRLAKQGD PKMKIHGVVA FKCENVATLD PITFETPESF ISLPKWNAKK
510 520 530 540 550
TGSISFDFRT TEPNGLILFS HGKPRHQKDA KHPQMIKVDF FAIEMLDGHL
560 570 580 590 600
YLLLDMGSGT IKIKALLKKV NDGEWYHVDF QRDGRSGTIS VNTLRTPYTA
610 620 630 640 650
PGESEILDLD DELYLGGLPE NKAGLVFPTE VWTALLNYGY VGCIRDLFID
660 670 680 690 700
GQSKDIRQMA EVQSTAGVKP SCSKETAKPC LSNPCKNNGM CRDGWNRYVC
710 720 730 740 750
DCSGTGYLGR SCEREATVLS YDGSMFMKIQ LPVVMHTEAE DVSLRFRSQR
760 770 780 790 800
AYGILMATTS RDSADTLRLE LDAGRVKLTV NLDCIRINCN SSKGPETLFA
810 820 830 840 850
GYNLNDNEWH TVRVVRRGKS LKLTVDDQQA MTGQMAGDHT RLEFHNIETG
860 870 880 890 900
IITERRYLSS VPSNFIGHLQ SLTFNGMAYI DLCKNGDIDY CELNARFGFR
910 920 930 940 950
NIIADPVTFK TKSSYVALAT LQAYTSMHLF FQFKTTSLDG LILYNSGDGN
960 970 980 990 1000
DFIVVELVKG YLHYVFDLGN GANLIKGSSN KPLNDNQWHN VMISRDTSNL
1010 1020 1030 1040 1050
HTVKIDTKIT TQITAGARNL DLKSDLYIGG VAKETYKSLP KLVHAKEGFQ
1060 1070 1080 1090 1100
GCLASVDLNG RLPDLISDAL FCNGQIERGC EGPSTTCQED SCSNQGVCLQ
1110 1120 1130 1140 1150
QWDGFSCDCS MTSFSGPLCN DPGTTYIFSK GGGQITYKWP PNDRPSTRAD
1160 1170 1180 1190 1200
RLAIGFSTVQ KEAVLVRVDS SSGLGDYLEL HIHQGKIGVK FNVGTDDIAI
1210 1220 1230 1240 1250
EESNAIINDG KYHVVRFTRS GGNATLQVDS WPVIERYPAG RQLTIFNSQA
1260 1270 1280 1290 1300
TIIIGGKEQG QPFQGQLSGL YYNGLKVLNM AAENDANIAI VGNVRLVGEV
1310 1320 1330 1340 1350
PSSMTTESTA TAMQSEMSTS IMETTTTLAT STARRGKPPT KEPISQTTDD
1360 1370 1380 1390 1400
ILVASAECPS DDEDIDPCEP SSGGLANPTR AGGREPYPGS AEVIRESSST
1410 1420 1430 1440 1450
TGMVVGIVAA AALCILILLY AMYKYRNRDE GSYHVDESRN YISNSAQSNG
1460 1470
AVVKEKQPSS AKSSNKNKKN KDKEYYV
Length:1,477
Mass (Da):161,883
Last modified:May 1, 2000 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iFF845FB428B1A683
GO
Isoform 2a (identifier: Q9ULB1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     379-386: Missing.
     1239-1239: A → AGNNDNERLAIARQRIPYRLGRVVDEWLLDK
     1373-1375: Missing.

Note: Produced by alternative splicing. No experimental confirmation available.
Show »
Length:1,496
Mass (Da):164,428
Checksum:i8A9B5DA4D7783F9D
GO
Isoform 3a (identifier: Q9ULB1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     258-258: E → EIKFGLQCVLPVLLHDNDQGKYCCINTAKPLTEK
     386-386: M → MVNKLHCS
     1239-1239: A → AGNNDNERLAIARQRIPYRLGRVVDEWLLDK

Note: Produced by alternative splicing.
Show »
Length:1,547
Mass (Da):169,913
Checksum:i2F6A3FBB6E53AA2E
GO
Isoform 3b (identifier: P58400-1) [UniParc]FASTAAdd to basket
The sequence of this isoform can be found in the external entry P58400.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
Length:442
Mass (Da):46,861
GO
Isoform 4 (identifier: Q9ULB1-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1335: Missing.
     1336-1344: GKPPTKEPI → MDMRWHCEN
     1373-1375: Missing.

Note: Produced by alternative promoter usage and alternative splicing.Curated
Show »
Length:139
Mass (Da):15,277
Checksum:iCB02C9A82E954D7F
GO
Isoform 1b (identifier: P58400-2) [UniParc]FASTAAdd to basket
The sequence of this isoform can be found in the external entry P58400.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
Length:472
Mass (Da):50,424
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 26 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E7ERL8E7ERL8_HUMAN
Neurexin-1-beta
NRXN1
1,507Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1D5RMU6A0A1D5RMU6_HUMAN
Neurexin-1-beta
NRXN1
1,499Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0R4J2G7A0A0R4J2G7_HUMAN
Neurexin-1-beta
NRXN1
1,495Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0D9SEM5A0A0D9SEM5_HUMAN
Neurexin-1-beta
NRXN1
469Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5GYC7F5GYC7_HUMAN
Neurexin-1-beta
NRXN1
836Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WB18F8WB18_HUMAN
Neurexin-1-beta
NRXN1
851Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0D9SF36A0A0D9SF36_HUMAN
Neurexin-1-beta
NRXN1
213Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0Y568H0Y568_HUMAN
Neurexin-1-beta
NRXN1
139Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7BYC7H7BYC7_HUMAN
Neurexin-1-beta
NRXN1
142Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q08AH0Q08AH0_HUMAN
NRXN1 protein
NRXN1
198Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There are more potential isoformsShow all

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAA25504 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti1360S → G in CAI46085 (PubMed:11230166).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_07027428G → A1 PublicationCorresponds to variant dbSNP:rs199598542Ensembl.1
Natural variantiVAR_050265400Y → N. Corresponds to variant dbSNP:rs17040901Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0582001 – 1335Missing in isoform 4. 1 PublicationAdd BLAST1335
Alternative sequenceiVSP_041353258E → EIKFGLQCVLPVLLHDNDQG KYCCINTAKPLTEK in isoform 3a. 1 Publication1
Alternative sequenceiVSP_014541379 – 386Missing in isoform 2a. 1 Publication8
Alternative sequenceiVSP_041354386M → MVNKLHCS in isoform 3a. 1 Publication1
Alternative sequenceiVSP_0413551239A → AGNNDNERLAIARQRIPYRL GRVVDEWLLDK in isoform 3a and isoform 2a. 2 Publications1
Alternative sequenceiVSP_0582011336 – 1344GKPPTKEPI → MDMRWHCEN in isoform 4. 1 Publication9
Alternative sequenceiVSP_0582021373 – 1375Missing in isoform 4 and isoform 2a. 2 Publications3

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
EF539882 mRNA Translation: ABS86974.1
AB035356 mRNA Translation: BAA87821.1
AB011150 mRNA Translation: BAA25504.2 Different initiation.
BX647616 mRNA Translation: CAI46085.1
AC007462 Genomic DNA Translation: AAF03536.1
AC007682 Genomic DNA Translation: AAY14894.1
AC009234 Genomic DNA Translation: AAY14944.1
AC068725 Genomic DNA Translation: AAG59602.1
AC069550 Genomic DNA Translation: AAG38120.1
AC078994 Genomic DNA Translation: AAK06387.1
AC068715 Genomic DNA Translation: AAG59642.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS46282.1 [Q9ULB1-3]
CCDS54360.1 [Q9ULB1-1]
CCDS82445.1 [Q9ULB1-4]
CCDS82450.1 [Q9ULB1-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001129131.1, NM_001135659.2 [Q9ULB1-3]
NP_004792.1, NM_004801.5 [Q9ULB1-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000404971; ENSP00000385142; ENSG00000179915 [Q9ULB1-3]
ENST00000406316; ENSP00000384311; ENSG00000179915 [Q9ULB1-1]
ENST00000625672; ENSP00000485887; ENSG00000179915 [Q9ULB1-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
9378

UCSC genome browser

More...
UCSCi
uc061jbb.1 human [Q9ULB1-1]

Keywords - Coding sequence diversityi

Alternative promoter usage, Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
EF539882 mRNA Translation: ABS86974.1
AB035356 mRNA Translation: BAA87821.1
AB011150 mRNA Translation: BAA25504.2 Different initiation.
BX647616 mRNA Translation: CAI46085.1
AC007462 Genomic DNA Translation: AAF03536.1
AC007682 Genomic DNA Translation: AAY14894.1
AC009234 Genomic DNA Translation: AAY14944.1
AC068725 Genomic DNA Translation: AAG59602.1
AC069550 Genomic DNA Translation: AAG38120.1
AC078994 Genomic DNA Translation: AAK06387.1
AC068715 Genomic DNA Translation: AAG59642.1
CCDSiCCDS46282.1 [Q9ULB1-3]
CCDS54360.1 [Q9ULB1-1]
CCDS82445.1 [Q9ULB1-4]
CCDS82450.1 [Q9ULB1-2]
RefSeqiNP_001129131.1, NM_001135659.2 [Q9ULB1-3]
NP_004792.1, NM_004801.5 [Q9ULB1-1]

3D structure databases

SMRiQ9ULB1
ModBaseiSearch...

Protein-protein interaction databases

BioGridi114779, 15 interactors
CORUMiQ9ULB1
IntActiQ9ULB1, 6 interactors
STRINGi9606.ENSP00000385142

Chemistry databases

DrugBankiDB11093 Calcium Citrate
DB11348 Calcium Phosphate
DB14481 Calcium phosphate dihydrate

Protein family/group databases

TCDBi8.A.74.1.2 the tm9 or phg1 targeting receptor (ppg1) family

PTM databases

GlyConnecti1548
iPTMnetiQ9ULB1
PhosphoSitePlusiQ9ULB1
SwissPalmiQ9ULB1

Polymorphism and mutation databases

BioMutaiNRXN1
DMDMi17369704

Proteomic databases

EPDiQ9ULB1
MassIVEiQ9ULB1
MaxQBiQ9ULB1
PaxDbiQ9ULB1
PeptideAtlasiQ9ULB1
PRIDEiQ9ULB1
ProteomicsDBi84967 [Q9ULB1-1]
84968 [Q9ULB1-2]
84969 [Q9ULB1-3]

Genome annotation databases

EnsembliENST00000404971; ENSP00000385142; ENSG00000179915 [Q9ULB1-3]
ENST00000406316; ENSP00000384311; ENSG00000179915 [Q9ULB1-1]
ENST00000625672; ENSP00000485887; ENSG00000179915 [Q9ULB1-2]
GeneIDi9378
UCSCiuc061jbb.1 human [Q9ULB1-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
9378
DisGeNETi9378

GeneCards: human genes, protein and diseases

More...
GeneCardsi
NRXN1
HGNCiHGNC:8008 NRXN1
HPAiHPA071400
MalaCardsiNRXN1
MIMi600565 gene
614325 phenotype
614332 phenotype
neXtProtiNX_Q9ULB1
OpenTargetsiENSG00000179915
Orphaneti106 NON RARE IN EUROPE: Autism
221150 Pitt-Hopkins-like syndrome
PharmGKBiPA31786

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3514 Eukaryota
ENOG410XNU6 LUCA
GeneTreeiENSGT00940000154292
InParanoidiQ9ULB1
OMAiLMMGDQX
OrthoDBi35129at2759
PhylomeDBiQ9ULB1
TreeFamiTF321302

Enzyme and pathway databases

ReactomeiR-HSA-3000171 Non-integrin membrane-ECM interactions
R-HSA-6794361 Neurexins and neuroligins
SIGNORiQ9ULB1

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
NRXN1 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
9378
PharosiQ9ULB1

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000179915 Expressed in 176 organ(s), highest expression level in corpus callosum
ExpressionAtlasiQ9ULB1 baseline and differential
GenevisibleiQ9ULB1 HS

Family and domain databases

InterProiView protein in InterPro
IPR013320 ConA-like_dom_sf
IPR000742 EGF-like_dom
IPR000152 EGF-type_Asp/Asn_hydroxyl_site
IPR001791 Laminin_G
IPR003585 Neurexin-like
IPR027789 Syndecan/Neurexin_dom
PfamiView protein in Pfam
PF00008 EGF, 1 hit
PF02210 Laminin_G_2, 6 hits
PF01034 Syndecan, 1 hit
SMARTiView protein in SMART
SM00294 4.1m, 1 hit
SM00181 EGF, 3 hits
SM00282 LamG, 6 hits
SUPFAMiSSF49899 SSF49899, 6 hits
PROSITEiView protein in PROSITE
PS00010 ASX_HYDROXYL, 1 hit
PS50026 EGF_3, 3 hits
PS50025 LAM_G_DOMAIN, 6 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiNRX1A_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9ULB1
Secondary accession number(s): A7KRL9
, O60323, Q53TJ9, Q53TQ1, Q5HYI0, Q9C079, Q9C080, Q9C081, Q9H3M2, Q9UDM6
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 16, 2001
Last sequence update: May 1, 2000
Last modified: October 16, 2019
This is version 194 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again