Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
We will be switching to the new UniProt website soon. Please explore and share your feedback. Take me to the new website.

UniProtKB - Q9UL19 (PLAT4_HUMAN)

Entry version 152 (23 Feb 2022)
Sequence version 1 (01 May 2000)
Previous versions | rss
Add a publicationFeedback
Protein

Phospholipase A and acyltransferase 4

Gene

PLAAT4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Exhibits both phospholipase A1/2 and acyltransferase activities (PubMed:19615464, PubMed:22605381, PubMed:22825852, PubMed:26503625).

Shows phospholipase A1 (PLA1) and A2 (PLA2), catalyzing the calcium-independent release of fatty acids from the sn-1 or sn-2 position of glycerophospholipids (PubMed:19615464, PubMed:22605381, PubMed:22825852).

For most substrates, PLA1 activity is much higher than PLA2 activity (PubMed:19615464).

Shows O-acyltransferase activity, catalyzing the transfer of a fatty acyl group from glycerophospholipid to the hydroxyl group of lysophospholipid (PubMed:19615464).

Shows N-acyltransferase activity, catalyzing the calcium-independent transfer of a fatty acyl group at the sn-1 position of phosphatidylcholine (PC) and other glycerophospholipids to the primary amine of phosphatidylethanolamine (PE), forming N-acylphosphatidylethanolamine (NAPE), which serves as precursor for N-acylethanolamines (NAEs) (PubMed:19615464, PubMed:22605381, PubMed:22825852).

Promotes keratinocyte differentiation via activation of TGM1 (PubMed:17762858).

1 Publication4 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the 'Function' section describes biophysical and chemical properties, such as maximal absorption, kinetic parameters, pH dependence, redox potentials and temperature dependence.<p><a href='/help/biophysicochemical_properties' target='_top'>More...</a></p>Kineticsi

  1. KM=400 µM for dipalmitoyl-PC1 Publication
  1. Vmax=530 nmol/min/mg enzyme with dipalmitoyl-PC as substrate1 Publication
  2. Vmax=240 nmol/min/mg enzyme with dipalmitoyl-PE as substrate1 Publication

pH dependencei

Optimum pH is 8.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei23PROSITE-ProRule annotation1
Active sitei35PROSITE-ProRule annotation1
Active sitei113Acyl-thioester intermediatePROSITE-ProRule annotation1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase, Transferase
Biological processLipid degradation, Lipid metabolism

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q9UL19

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-1482839, Acyl chain remodelling of PE

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...SignaLinki		Q9UL19

Chemistry databases

SwissLipids knowledge resource for lipid biology

More...SwissLipidsi		SLP:000001076

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Phospholipase A and acyltransferase 4Imported (EC:2.3.1.-3 Publications, EC:3.1.1.323 Publications, EC:3.1.1.43 Publications)
Alternative name(s):
HRAS-like suppressor 4
Short name:
HRSL4
RAR-responsive protein TIG3
Retinoic acid receptor responder protein 3
Retinoid-inducible gene 1 protein
Tazarotene-induced gene 3 protein
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:PLAAT4Imported
Synonyms:RARRES3, RIG1, TIG3
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 11

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:9869, PLAAT4

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		605092, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q9UL19

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000133321

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 134CytoplasmicSequence analysisAdd BLAST134
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei135 – 155HelicalSequence analysisAdd BLAST21
Topological domaini156 – 164LumenalSequence analysis9

Keywords - Cellular componenti

Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		5920

Open Targets

More...OpenTargetsi		ENSG00000133321

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA34230

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q9UL19, Tbio

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...ChEMBLi		CHEMBL4630864

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		RARRES3

Domain mapping of disease mutations (DMDM)

More...DMDMi		20140910

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001524901 – 164Phospholipase A and acyltransferase 4Add BLAST164

Proteomic databases

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q9UL19

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q9UL19

PeptideAtlas

More...PeptideAtlasi		Q9UL19

PRoteomics IDEntifications database

More...PRIDEi		Q9UL19

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		84932 [Q9UL19-1]
84933 [Q9UL19-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q9UL19

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q9UL19

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Widely expressed.2 Publications

<p>This subsection of the 'Expression' section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

By all-trans-retinoic acid and synthetic retinoids.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000133321, Expressed in epithelium of bronchus and 239 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q9UL19, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q9UL19, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000133321, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with TGM1.

1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		111855, 26 interactors

Protein interaction database and analysis system

More...IntActi		Q9UL19, 2 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000255688

Chemistry databases

BindingDB database of measured binding affinities

More...BindingDBi		Q9UL19

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q9UL19, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1164
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Biological Magnetic Resonance Data Bank

More...BMRBi		Q9UL19

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q9UL19

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini13 – 129LRATPROSITE-ProRule annotationAdd BLAST117

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 40Essential for its ability regulate keratinocyte differentiation1 PublicationAdd BLAST40
Regioni124 – 164Interaction with TGM11 PublicationAdd BLAST41

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the H-rev107 family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		ENOG502S0JN, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000162878

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_109418_0_1_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q9UL19

Database of Orthologous Groups

More...OrthoDBi		1602481at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q9UL19

TreeFam database of animal gene trees

More...TreeFami		TF330836

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR007053, LRAT_dom
IPR033210, PLAAT4

The PANTHER Classification System

More...PANTHERi		PTHR13943:SF36, PTHR13943:SF36, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF04970, LRAT, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS51934, LRAT, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9UL19-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <p><strong>What is the canonical sequence?</strong><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MASPHQEPKP GDLIEIFRLG YEHWALYIGD GYVIHLAPPS EYPGAGSSSV 
        60         70         80         90        100
FSVLSNSAEV KRERLEDVVG GCCYRVNNSL DHEYQPRPVE VIISSAKEMV 
       110        120        130        140        150
GQKMKYSIVS RNCEHFVTQL RYGKSRCKQV EKAKVEVGVA TALGILVVAG 
       160 
CSFAIRRYQK KATA
Length:164
Mass (Da):18,179
Last modified:May 1, 2000 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i95625B8FD375FD38
GO
Isoform 2 (identifier: Q9UL19-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     131-164: EKAKVEVGVATALGILVVAGCSFAIRRYQKKATA → RTSLDNPSPSAWGWTHGAVQPGDHCE

Show »
Length:156
Mass (Da):17,436
Checksum:iC9DA5B23E1BC9C8A
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A6NG31A6NG31_HUMAN
Phospholipase A and acyltransferase...
PLAAT4
164Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti44G → R in BAG56873 (PubMed:14702039).Curated1
Sequence conflicti63E → G in AAC84000 (PubMed:9843971).Curated1
Sequence conflicti118T → A in AAC84000 (PubMed:9843971).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_04948069V → L. Corresponds to variant dbSNP:rs35502888Ensembl.1
Natural variantiVAR_049481162A → V. Corresponds to variant dbSNP:rs35845275Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_041496131 – 164EKAKV…KKATA → RTSLDNPSPSAWGWTHGAVQ PGDHCE in isoform 2. 1 PublicationAdd BLAST34

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AF060228 mRNA Translation: AAC84000.1
AF092922 mRNA Translation: AAF02294.1
AB453252 mRNA Translation: BAH22446.1
AB030815 mRNA Translation: BAB08109.1
AK293357 mRNA Translation: BAG56873.1
AK312110 mRNA Translation: BAG35046.1
AP001591 Genomic DNA No translation available.
CH471076 Genomic DNA Translation: EAW74156.1
BC009678 mRNA Translation: AAH09678.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS41662.1 [Q9UL19-1]

NCBI Reference Sequences

More...RefSeqi		NP_004576.2, NM_004585.4 [Q9UL19-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000255688; ENSP00000255688; ENSG00000133321
ENST00000439013; ENSP00000402943; ENSG00000133321 [Q9UL19-2]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		5920

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:5920

Matched Annotation from NCBI and EMBL-EBI (MANE) - Phase one

More...MANE-Selecti		ENST00000255688.8; ENSP00000255688.3; NM_004585.5; NP_004576.2

UCSC genome browser

More...UCSCi		uc001nxf.5, human [Q9UL19-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross%5Freferences%5Fsection">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF060228 mRNA Translation: AAC84000.1
AF092922 mRNA Translation: AAF02294.1
AB453252 mRNA Translation: BAH22446.1
AB030815 mRNA Translation: BAB08109.1
AK293357 mRNA Translation: BAG56873.1
AK312110 mRNA Translation: BAG35046.1
AP001591 Genomic DNA No translation available.
CH471076 Genomic DNA Translation: EAW74156.1
BC009678 mRNA Translation: AAH09678.1
CCDSiCCDS41662.1 [Q9UL19-1]
RefSeqiNP_004576.2, NM_004585.4 [Q9UL19-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2LKTNMR-A1-125[»]
2MY9NMR-A1-125[»]
BMRBiQ9UL19
SMRiQ9UL19
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi111855, 26 interactors
IntActiQ9UL19, 2 interactors
STRINGi9606.ENSP00000255688

Chemistry databases

BindingDBiQ9UL19
ChEMBLiCHEMBL4630864
SwissLipidsiSLP:000001076

PTM databases

iPTMnetiQ9UL19
PhosphoSitePlusiQ9UL19

Genetic variation databases

BioMutaiRARRES3
DMDMi20140910

Proteomic databases

MassIVEiQ9UL19
PaxDbiQ9UL19
PeptideAtlasiQ9UL19
PRIDEiQ9UL19
ProteomicsDBi84932 [Q9UL19-1]
84933 [Q9UL19-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		2443, 239 antibodies from 35 providers

The DNASU plasmid repository

More...DNASUi		5920

Genome annotation databases

EnsembliENST00000255688; ENSP00000255688; ENSG00000133321
ENST00000439013; ENSP00000402943; ENSG00000133321 [Q9UL19-2]
GeneIDi5920
KEGGihsa:5920
MANE-SelectiENST00000255688.8; ENSP00000255688.3; NM_004585.5; NP_004576.2
UCSCiuc001nxf.5, human [Q9UL19-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		5920
DisGeNETi5920

GeneCards: human genes, protein and diseases

More...GeneCardsi		PLAAT4
HGNCiHGNC:9869, PLAAT4
HPAiENSG00000133321, Low tissue specificity
MIMi605092, gene
neXtProtiNX_Q9UL19
OpenTargetsiENSG00000133321
PharmGKBiPA34230
VEuPathDBiHostDB:ENSG00000133321

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiENOG502S0JN, Eukaryota
GeneTreeiENSGT00940000162878
HOGENOMiCLU_109418_0_1_1
InParanoidiQ9UL19
OrthoDBi1602481at2759
PhylomeDBiQ9UL19
TreeFamiTF330836

Enzyme and pathway databases

PathwayCommonsiQ9UL19
ReactomeiR-HSA-1482839, Acyl chain remodelling of PE
SignaLinkiQ9UL19

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		5920, 9 hits in 1044 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		RARRES3, human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		RARRES3

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		5920
PharosiQ9UL19, Tbio

Protein Ontology

More...PROi		PR:Q9UL19
RNActiQ9UL19, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000133321, Expressed in epithelium of bronchus and 239 other tissues
ExpressionAtlasiQ9UL19, baseline and differential
GenevisibleiQ9UL19, HS

Family and domain databases

InterProiView protein in InterPro
IPR007053, LRAT_dom
IPR033210, PLAAT4
PANTHERiPTHR13943:SF36, PTHR13943:SF36, 1 hit
PfamiView protein in Pfam
PF04970, LRAT, 1 hit
PROSITEiView protein in PROSITE
PS51934, LRAT, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPLAT4_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9UL19
Secondary accession number(s): B2R599
, B4DDW2, E7ENZ7, O95200
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 31, 2002
Last sequence update: May 1, 2000
Last modified: February 23, 2022
This is version 152 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again