Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

BAG family molecular chaperone regulator 5

Gene

BAG5

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Inhibits both auto-ubiquitination of PRKN and ubiquitination of target proteins by PRKN (By similarity). May function as a nucleotide exchange factor for HSP/HSP70, promoting ADP release, and activating Hsp70-mediated refolding.By similarity1 Publication

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionChaperone

Enzyme and pathway databases

ReactomeiR-HSA-3371453 Regulation of HSF1-mediated heat shock response

Names & Taxonomyi

Protein namesi
Recommended name:
BAG family molecular chaperone regulator 5
Short name:
BAG-5
Alternative name(s):
Bcl-2-associated athanogene 5
Gene namesi
Name:BAG5
Synonyms:KIAA0873
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 14

Organism-specific databases

EuPathDBiHostDB:ENSG00000166170.9
HGNCiHGNC:941 BAG5
MIMi603885 gene
neXtProtiNX_Q9UL15

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Pathology & Biotechi

Organism-specific databases

DisGeNETi9529
OpenTargetsiENSG00000166170
PharmGKBiPA25241

Polymorphism and mutation databases

BioMutaiBAG5
DMDMi12643895

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000888721 – 447BAG family molecular chaperone regulator 5Add BLAST447

Proteomic databases

EPDiQ9UL15
PaxDbiQ9UL15
PeptideAtlasiQ9UL15
PRIDEiQ9UL15
ProteomicsDBi84927
84928 [Q9UL15-2]

PTM databases

iPTMnetiQ9UL15
PhosphoSitePlusiQ9UL15

Expressioni

Gene expression databases

BgeeiENSG00000166170 Expressed in 235 organ(s), highest expression level in testis
CleanExiHS_BAG5
ExpressionAtlasiQ9UL15 baseline and differential
GenevisibleiQ9UL15 HS

Organism-specific databases

HPAiHPA016429

Interactioni

Subunit structurei

Binds to the ATPase domain of HSP/HSC70 chaperones. Binds PRKN.1 Publication

Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

BioGridi114905, 46 interactors
CORUMiQ9UL15
DIPiDIP-53428N
IntActiQ9UL15, 53 interactors
MINTiQ9UL15
STRINGi9606.ENSP00000338814

Structurei

Secondary structure

1447
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliQ9UL15
SMRiQ9UL15
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9UL15

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini9 – 86BAG 1PROSITE-ProRule annotationAdd BLAST78
Domaini95 – 167BAG 2PROSITE-ProRule annotationAdd BLAST73
Domaini182 – 260BAG 3PROSITE-ProRule annotationAdd BLAST79
Domaini275 – 350BAG 4PROSITE-ProRule annotationAdd BLAST76
Domaini365 – 442BAG 5PROSITE-ProRule annotationAdd BLAST78

Domaini

The fifth BAG domain is responsible for the interaction with HSP70 nucleotide-binding domain.1 Publication

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG4361 Eukaryota
ENOG4111WNH LUCA
GeneTreeiENSGT00530000063256
HOGENOMiHOG000070447
HOVERGENiHBG004810
InParanoidiQ9UL15
KOiK09559
OMAiRTEIRNY
OrthoDBiEOG091G08LY
PhylomeDBiQ9UL15
TreeFamiTF102014

Family and domain databases

Gene3Di1.20.58.120, 5 hits
InterProiView protein in InterPro
IPR039773 BAG_chaperone_regulator
IPR036533 BAG_dom_sf
IPR003103 BAG_domain
PANTHERiPTHR12329 PTHR12329, 1 hit
PfamiView protein in Pfam
PF02179 BAG, 4 hits
SMARTiView protein in SMART
SM00264 BAG, 4 hits
SUPFAMiSSF63491 SSF63491, 4 hits
PROSITEiView protein in PROSITE
PS51035 BAG, 4 hits

Sequences (2+)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9UL15-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDMGNQHPSI SRLQEIQKEV KSVEQQVIGF SGLSDDKNYK KLERILTKQL
60 70 80 90 100
FEIDSVDTEG KGDIQQARKR AAQETERLLK ELEQNANHPH RIEIQNIFEE
110 120 130 140 150
AQSLVREKIV PFYNGGNCVT DEFEEGIQDI ILRLTHVKTG GKISLRKARY
160 170 180 190 200
HTLTKICAVQ EIIEDCMKKQ PSLPLSEDAH PSVAKINFVM CEVNKARGVL
210 220 230 240 250
IALLMGVNNN ETCRHLSCVL SGLIADLDAL DVCGRTEIRN YRREVVEDIN
260 270 280 290 300
KLLKYLDLEE EADTTKAFDL RQNHSILKIE KVLKRMREIK NELLQAQNPS
310 320 330 340 350
ELYLSSKTEL QGLIGQLDEV SLEKNPCIRE ARRRAVIEVQ TLITYIDLKE
360 370 380 390 400
ALEKRKLFAC EEHPSHKAVW NVLGNLSEIQ GEVLSFDGNR TDKNYIRLEE
410 420 430 440
LLTKQLLALD AVDPQGEEKC KAARKQAVRL AQNILSYLDL KSDEWEY
Length:447
Mass (Da):51,200
Last modified:May 1, 2000 - v1
Checksum:i0D3F7EA6B612C1F5
GO
Isoform 2 (identifier: Q9UL15-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MRFHWLPTLSEPFDRNQELETCIRPLWTPSGSACETEHNKSM

Note: No experimental confirmation available.
Show »
Length:488
Mass (Da):56,027
Checksum:i7A901A14F9B07AC2
GO

Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
G3V274G3V274_HUMAN
BAG family molecular chaperone regu...
BAG5
211Annotation score:

Sequence cautioni

The sequence BAA74896 differs from that shown. Reason: Erroneous initiation.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_058712157C → W1 PublicationCorresponds to variant dbSNP:rs17854644Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0379961M → MRFHWLPTLSEPFDRNQELE TCIRPLWTPSGSACETEHNK SM in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF095195 mRNA Translation: AAD16124.2
AB020680 mRNA Translation: BAA74896.1 Different initiation.
AL139300 Genomic DNA No translation available.
BC044216 mRNA Translation: AAH44216.2
BC050551 mRNA Translation: AAH50551.1
CCDSiCCDS41995.1 [Q9UL15-2]
CCDS9982.1 [Q9UL15-1]
RefSeqiNP_001015048.1, NM_001015048.2 [Q9UL15-1]
NP_001015049.1, NM_001015049.2 [Q9UL15-2]
NP_004864.1, NM_004873.3 [Q9UL15-1]
UniGeneiHs.5443

Genome annotation databases

EnsembliENST00000299204; ENSP00000299204; ENSG00000166170 [Q9UL15-1]
ENST00000337322; ENSP00000338814; ENSG00000166170 [Q9UL15-2]
ENST00000445922; ENSP00000391713; ENSG00000166170 [Q9UL15-1]
GeneIDi9529
KEGGihsa:9529
UCSCiuc001ynh.3 human [Q9UL15-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF095195 mRNA Translation: AAD16124.2
AB020680 mRNA Translation: BAA74896.1 Different initiation.
AL139300 Genomic DNA No translation available.
BC044216 mRNA Translation: AAH44216.2
BC050551 mRNA Translation: AAH50551.1
CCDSiCCDS41995.1 [Q9UL15-2]
CCDS9982.1 [Q9UL15-1]
RefSeqiNP_001015048.1, NM_001015048.2 [Q9UL15-1]
NP_001015049.1, NM_001015049.2 [Q9UL15-2]
NP_004864.1, NM_004873.3 [Q9UL15-1]
UniGeneiHs.5443

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2D9DNMR-A275-350[»]
3A8YX-ray2.30C/D341-447[»]
ProteinModelPortaliQ9UL15
SMRiQ9UL15
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi114905, 46 interactors
CORUMiQ9UL15
DIPiDIP-53428N
IntActiQ9UL15, 53 interactors
MINTiQ9UL15
STRINGi9606.ENSP00000338814

PTM databases

iPTMnetiQ9UL15
PhosphoSitePlusiQ9UL15

Polymorphism and mutation databases

BioMutaiBAG5
DMDMi12643895

Proteomic databases

EPDiQ9UL15
PaxDbiQ9UL15
PeptideAtlasiQ9UL15
PRIDEiQ9UL15
ProteomicsDBi84927
84928 [Q9UL15-2]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000299204; ENSP00000299204; ENSG00000166170 [Q9UL15-1]
ENST00000337322; ENSP00000338814; ENSG00000166170 [Q9UL15-2]
ENST00000445922; ENSP00000391713; ENSG00000166170 [Q9UL15-1]
GeneIDi9529
KEGGihsa:9529
UCSCiuc001ynh.3 human [Q9UL15-1]

Organism-specific databases

CTDi9529
DisGeNETi9529
EuPathDBiHostDB:ENSG00000166170.9
GeneCardsiBAG5
HGNCiHGNC:941 BAG5
HPAiHPA016429
MIMi603885 gene
neXtProtiNX_Q9UL15
OpenTargetsiENSG00000166170
PharmGKBiPA25241
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG4361 Eukaryota
ENOG4111WNH LUCA
GeneTreeiENSGT00530000063256
HOGENOMiHOG000070447
HOVERGENiHBG004810
InParanoidiQ9UL15
KOiK09559
OMAiRTEIRNY
OrthoDBiEOG091G08LY
PhylomeDBiQ9UL15
TreeFamiTF102014

Enzyme and pathway databases

ReactomeiR-HSA-3371453 Regulation of HSF1-mediated heat shock response

Miscellaneous databases

EvolutionaryTraceiQ9UL15
GeneWikiiBAG5
GenomeRNAii9529
PROiPR:Q9UL15
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000166170 Expressed in 235 organ(s), highest expression level in testis
CleanExiHS_BAG5
ExpressionAtlasiQ9UL15 baseline and differential
GenevisibleiQ9UL15 HS

Family and domain databases

Gene3Di1.20.58.120, 5 hits
InterProiView protein in InterPro
IPR039773 BAG_chaperone_regulator
IPR036533 BAG_dom_sf
IPR003103 BAG_domain
PANTHERiPTHR12329 PTHR12329, 1 hit
PfamiView protein in Pfam
PF02179 BAG, 4 hits
SMARTiView protein in SMART
SM00264 BAG, 4 hits
SUPFAMiSSF63491 SSF63491, 4 hits
PROSITEiView protein in PROSITE
PS51035 BAG, 4 hits
ProtoNetiSearch...

Entry informationi

Entry nameiBAG5_HUMAN
AccessioniPrimary (citable) accession number: Q9UL15
Secondary accession number(s): O94950, Q86W59
Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 11, 2001
Last sequence update: May 1, 2000
Last modified: November 7, 2018
This is version 156 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. Human chromosome 14
    Human chromosome 14: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again