Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Guanine nucleotide exchange factor VAV3

Gene

VAV3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Exchange factor for GTP-binding proteins RhoA, RhoG and, to a lesser extent, Rac1. Binds physically to the nucleotide-free states of those GTPases. Plays an important role in angiogenesis. Its recruitment by phosphorylated EPHA2 is critical for EFNA1-induced RAC1 GTPase activation and vascular endothelial cell migration and assembly (By similarity). May be important for integrin-mediated signaling, at least in some cell types. In osteoclasts, along with SYK tyrosine kinase, required for signaling through integrin alpha-v/beta-1 (ITAGV-ITGB1), a crucial event for osteoclast proper cytoskeleton organization and function. This signaling pathway involves RAC1, but not RHO, activation. Necessary for proper wound healing. In the course of wound healing, required for the phagocytotic cup formation preceding macrophage phagocytosis of apoptotic neutrophils. Responsible for integrin beta-2 (ITGB2)-mediated macrophage adhesion and, to a lesser extent, contributes to beta-3 (ITGB3)-mediated adhesion. Does not affect integrin beta-1 (ITGB1)-mediated adhesion (By similarity).By similarity

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri513 – 562Phorbol-ester/DAG-typePROSITE-ProRule annotationAdd BLAST50

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionGuanine-nucleotide releasing factor
Biological processAngiogenesis
LigandMetal-binding, Zinc

Enzyme and pathway databases

ReactomeiR-HSA-114604 GPVI-mediated activation cascade
R-HSA-193648 NRAGE signals death through JNK
R-HSA-194840 Rho GTPase cycle
R-HSA-2029482 Regulation of actin dynamics for phagocytic cup formation
R-HSA-2424491 DAP12 signaling
R-HSA-2871796 FCERI mediated MAPK activation
R-HSA-2871809 FCERI mediated Ca+2 mobilization
R-HSA-3928665 EPH-ephrin mediated repulsion of cells
R-HSA-416482 G alpha (12/13) signalling events
R-HSA-4420097 VEGFA-VEGFR2 Pathway
R-HSA-5218920 VEGFR2 mediated vascular permeability
SignaLinkiQ9UKW4
SIGNORiQ9UKW4

Names & Taxonomyi

Protein namesi
Recommended name:
Guanine nucleotide exchange factor VAV3
Short name:
VAV-3
Gene namesi
Name:VAV3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

EuPathDBiHostDB:ENSG00000134215.15
HGNCiHGNC:12659 VAV3
MIMi605541 gene
neXtProtiNX_Q9UKW4

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Pathology & Biotechi

Organism-specific databases

DisGeNETi10451
OpenTargetsiENSG00000134215
PharmGKBiPA37282

Polymorphism and mutation databases

BioMutaiVAV3
DMDMi12643372

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000809861 – 847Guanine nucleotide exchange factor VAV3Add BLAST847

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei141PhosphotyrosineCombined sources1

Post-translational modificationi

Phosphorylated. Phosphorylation can be mediated by ROS1. In osteoclasts, undergoes tyrosine phosphorylation in response to CSF1 (By similarity).By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ9UKW4
PaxDbiQ9UKW4
PeptideAtlasiQ9UKW4
PRIDEiQ9UKW4
ProteomicsDBi84896
84897 [Q9UKW4-2]
84898 [Q9UKW4-3]
84899 [Q9UKW4-4]

PTM databases

iPTMnetiQ9UKW4
PhosphoSitePlusiQ9UKW4

Expressioni

Tissue specificityi

Isoform 1 and isoform 3 are widely expressed; both are expressed at very low levels in skeletal muscle. In keratinocytes, isoform 1 is less abundant than isoform 3. Isoform 3 is detected at very low levels, if any, in adrenal gland, bone marrow, spleen, fetal brain and spinal chord; in these tissues, isoform 1 is readily detectable.2 Publications

Inductioni

Down-regulated by EGF and TGF-beta.1 Publication

Gene expression databases

BgeeiENSG00000134215 Expressed in 203 organ(s), highest expression level in tongue squamous epithelium
CleanExiHS_VAV3
ExpressionAtlasiQ9UKW4 baseline and differential
GenevisibleiQ9UKW4 HS

Organism-specific databases

HPAiCAB002012

Interactioni

Subunit structurei

Interacts with the PH domain of APS. Interacts (via SH2 domains) with the phosphorylated form of EPHA2. Interacts with ROS1; constitutive interaction that mediates VAV3 phosphorylation.3 Publications

Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

BioGridi115715, 18 interactors
IntActiQ9UKW4, 15 interactors
MINTiQ9UKW4
STRINGi9606.ENSP00000359073

Structurei

Secondary structure

1847
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliQ9UKW4
SMRiQ9UKW4
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9UKW4

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini1 – 119Calponin-homology (CH)PROSITE-ProRule annotationAdd BLAST119
Domaini192 – 371DHPROSITE-ProRule annotationAdd BLAST180
Domaini400 – 502PHPROSITE-ProRule annotationAdd BLAST103
Domaini592 – 660SH3 1PROSITE-ProRule annotationAdd BLAST69
Domaini672 – 766SH2PROSITE-ProRule annotationAdd BLAST95
Domaini788 – 847SH3 2PROSITE-ProRule annotationAdd BLAST60

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni560 – 847Sufficient for interaction with ROS11 PublicationAdd BLAST288

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri513 – 562Phorbol-ester/DAG-typePROSITE-ProRule annotationAdd BLAST50

Keywords - Domaini

Repeat, SH2 domain, SH3 domain, Zinc-finger

Phylogenomic databases

eggNOGiKOG2996 Eukaryota
ENOG410XPH6 LUCA
GeneTreeiENSGT00930000150930
HOGENOMiHOG000234364
HOVERGENiHBG018066
InParanoidiQ9UKW4
KOiK05730
OMAiAKQDRHI
OrthoDBiEOG091G01O3
PhylomeDBiQ9UKW4
TreeFamiTF316171

Family and domain databases

CDDicd00029 C1, 1 hit
cd00014 CH, 1 hit
cd01223 PH_Vav, 1 hit
cd00160 RhoGEF, 1 hit
cd10407 SH2_Vav3, 1 hit
cd11978 SH3_VAV3_2, 1 hit
Gene3Di1.10.418.10, 1 hit
1.20.900.10, 1 hit
2.30.29.30, 1 hit
3.30.505.10, 1 hit
InterProiView protein in InterPro
IPR022613 CAMSAP_CH
IPR001715 CH-domain
IPR036872 CH_dom_sf
IPR035899 DBL_dom_sf
IPR000219 DH-domain
IPR001331 GDS_CDC24_CS
IPR002219 PE/DAG-bd
IPR011993 PH-like_dom_sf
IPR001849 PH_domain
IPR037832 PH_Vav
IPR000980 SH2
IPR036860 SH2_dom_sf
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain
IPR003096 SM22_calponin
IPR035881 VAV3_SH2
IPR035734 VAV3_SH3_2
PfamiView protein in Pfam
PF00130 C1_1, 1 hit
PF11971 CAMSAP_CH, 1 hit
PF00169 PH, 1 hit
PF00621 RhoGEF, 1 hit
PF00017 SH2, 1 hit
PF07653 SH3_2, 2 hits
PRINTSiPR00401 SH2DOMAIN
PR00452 SH3DOMAIN
PR00888 SM22CALPONIN
SMARTiView protein in SMART
SM00109 C1, 1 hit
SM00033 CH, 1 hit
SM00233 PH, 1 hit
SM00325 RhoGEF, 1 hit
SM00252 SH2, 1 hit
SM00326 SH3, 2 hits
SUPFAMiSSF47576 SSF47576, 1 hit
SSF48065 SSF48065, 1 hit
SSF50044 SSF50044, 2 hits
SSF55550 SSF55550, 1 hit
PROSITEiView protein in PROSITE
PS50021 CH, 1 hit
PS00741 DH_1, 1 hit
PS50010 DH_2, 1 hit
PS50003 PH_DOMAIN, 1 hit
PS50001 SH2, 1 hit
PS50002 SH3, 2 hits
PS00479 ZF_DAG_PE_1, 1 hit
PS50081 ZF_DAG_PE_2, 1 hit

Sequences (4+)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative promoter usage and alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9UKW4-1) [UniParc]FASTAAdd to basket
Also known as: Alpha

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEPWKQCAQW LIHCKVLPTN HRVTWDSAQV FDLAQTLRDG VLLCQLLNNL
60 70 80 90 100
RAHSINLKEI NLRPQMSQFL CLKNIRTFLT ACCETFGMRK SELFEAFDLF
110 120 130 140 150
DVRDFGKVIE TLSRLSRTPI ALATGIRPFP TEESINDEDI YKGLPDLIDE
160 170 180 190 200
TLVEDEEDLY DCVYGEDEGG EVYEDLMKAE EAHQPKCPEN DIRSCCLAEI
210 220 230 240 250
KQTEEKYTET LESIEKYFMA PLKRFLTAAE FDSVFINIPE LVKLHRNLMQ
260 270 280 290 300
EIHDSIVNKN DQNLYQVFIN YKERLVIYGQ YCSGVESAIS SLDYISKTKE
310 320 330 340 350
DVKLKLEECS KRANNGKFTL RDLLVVPMQR VLKYHLLLQE LVKHTTDPTE
360 370 380 390 400
KANLKLALDA MKDLAQYVNE VKRDNETLRE IKQFQLSIEN LNQPVLLFGR
410 420 430 440 450
PQGDGEIRIT TLDKHTKQER HIFLFDLAVI VCKRKGDNYE MKEIIDLQQY
460 470 480 490 500
KIANNPTTDK ENKKWSYGFY LIHTQGQNGL EFYCKTKDLK KKWLEQFEMA
510 520 530 540 550
LSNIRPDYAD SNFHDFKMHT FTRVTSCKVC QMLLRGTFYQ GYLCFKCGAR
560 570 580 590 600
AHKECLGRVD NCGRVNSGEQ GTLKLPEKRT NGLRRTPKQV DPGLPKMQVI
610 620 630 640 650
RNYSGTPPPA LHEGPPLQLQ AGDTVELLKG DAHSLFWQGR NLASGEVGFF
660 670 680 690 700
PSDAVKPCPC VPKPVDYSCQ PWYAGAMERL QAETELINRV NSTYLVRHRT
710 720 730 740 750
KESGEYAISI KYNNEAKHIK ILTRDGFFHI AENRKFKSLM ELVEYYKHHS
760 770 780 790 800
LKEGFRTLDT TLQFPYKEPE HSAGQRGNRA GNSLLSPKVL GIAIARYDFC
810 820 830 840
ARDMRELSLL KGDVVKIYTK MSANGWWRGE VNGRVGWFPS TYVEEDE
Length:847
Mass (Da):97,776
Last modified:May 1, 2000 - v1
Checksum:iC1E29F0B094CB721
GO
Isoform 2 (identifier: Q9UKW4-2) [UniParc]FASTAAdd to basket
Also known as: Beta

The sequence of this isoform differs from the canonical sequence as follows:
     1-107: MEPWKQCAQW...DLFDVRDFGK → MQLPDCPCRAHLP

Show »
Length:753
Mass (Da):86,696
Checksum:iA67868CBD2FFD9A7
GO
Isoform 3 (identifier: Q9UKW4-3) [UniParc]FASTAAdd to basket
Also known as: VAV3.1

The sequence of this isoform differs from the canonical sequence as follows:
     1-560: Missing.
     561-568: NCGRVNSG → MPIFTFLS

Note: May be produced by alternative promoter usage.
Show »
Length:287
Mass (Da):32,604
Checksum:iD23C21EBEF7F48CF
GO
Isoform 4 (identifier: Q9UKW4-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     783-784: SL → SSPSLFCGFSFVTPPDYSFVPPSSTPFWSV

Note: No experimental confirmation available.
Show »
Length:875
Mass (Da):100,828
Checksum:iAD6B651338EEE812
GO

Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0YDG2H0YDG2_HUMAN
Guanine nucleotide exchange factor ...
VAV3
616Annotation score:
H0YCG7H0YCG7_HUMAN
Guanine nucleotide exchange factor ...
VAV3
182Annotation score:
E9PMJ5E9PMJ5_HUMAN
Guanine nucleotide exchange factor ...
VAV3
52Annotation score:

Sequence cautioni

The sequence AAD03799 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti107K → E in AAC79695 (PubMed:9705494).Curated1
Sequence conflicti217Y → H in AAD20348 (PubMed:10523675).Curated1
Sequence conflicti429V → A in AAD20348 (PubMed:10523675).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_061800139D → N. Corresponds to variant dbSNP:rs34318889Ensembl.1
Natural variantiVAR_033522298T → S2 PublicationsCorresponds to variant dbSNP:rs7528153Ensembl.1
Natural variantiVAR_051998616P → S. Corresponds to variant dbSNP:rs12410676Ensembl.1
Natural variantiVAR_033523618Q → H. Corresponds to variant dbSNP:rs12403266Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0413601 – 560Missing in isoform 3. 2 PublicationsAdd BLAST560
Alternative sequenceiVSP_0018201 – 107MEPWK…RDFGK → MQLPDCPCRAHLP in isoform 2. 1 PublicationAdd BLAST107
Alternative sequenceiVSP_041361561 – 568NCGRVNSG → MPIFTFLS in isoform 3. 2 Publications8
Alternative sequenceiVSP_042359783 – 784SL → SSPSLFCGFSFVTPPDYSFV PPSSTPFWSV in isoform 4. 1 Publication2

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF035442 mRNA Translation: AAD03799.1 Different initiation.
AF067817 mRNA Translation: AAC79695.1
AF118887 mRNA Translation: AAD20349.1
AF118886 mRNA Translation: AAD20348.1
AK304088 mRNA Translation: BAG64994.1
AK316295 mRNA Translation: BAH14666.1
AC114491 Genomic DNA No translation available.
AL353892 Genomic DNA No translation available.
AL391235 Genomic DNA No translation available.
AL513206 Genomic DNA No translation available.
AL591042 Genomic DNA No translation available.
CH471156 Genomic DNA Translation: EAW51252.1
BC143969 mRNA Translation: AAI43970.1
CCDSiCCDS44181.1 [Q9UKW4-3]
CCDS785.1 [Q9UKW4-1]
RefSeqiNP_001073343.1, NM_001079874.1 [Q9UKW4-3]
NP_006104.4, NM_006113.4 [Q9UKW4-1]
XP_005270417.1, XM_005270360.2 [Q9UKW4-2]
UniGeneiHs.267659

Genome annotation databases

EnsembliENST00000370056; ENSP00000359073; ENSG00000134215 [Q9UKW4-1]
ENST00000415432; ENSP00000394897; ENSG00000134215 [Q9UKW4-3]
ENST00000527011; ENSP00000432540; ENSG00000134215 [Q9UKW4-4]
GeneIDi10451
KEGGihsa:10451
UCSCiuc001dvj.2 human [Q9UKW4-1]

Keywords - Coding sequence diversityi

Alternative promoter usage, Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF035442 mRNA Translation: AAD03799.1 Different initiation.
AF067817 mRNA Translation: AAC79695.1
AF118887 mRNA Translation: AAD20349.1
AF118886 mRNA Translation: AAD20348.1
AK304088 mRNA Translation: BAG64994.1
AK316295 mRNA Translation: BAH14666.1
AC114491 Genomic DNA No translation available.
AL353892 Genomic DNA No translation available.
AL391235 Genomic DNA No translation available.
AL513206 Genomic DNA No translation available.
AL591042 Genomic DNA No translation available.
CH471156 Genomic DNA Translation: EAW51252.1
BC143969 mRNA Translation: AAI43970.1
CCDSiCCDS44181.1 [Q9UKW4-3]
CCDS785.1 [Q9UKW4-1]
RefSeqiNP_001073343.1, NM_001079874.1 [Q9UKW4-3]
NP_006104.4, NM_006113.4 [Q9UKW4-1]
XP_005270417.1, XM_005270360.2 [Q9UKW4-2]
UniGeneiHs.267659

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2D86NMR-A1-130[»]
ProteinModelPortaliQ9UKW4
SMRiQ9UKW4
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi115715, 18 interactors
IntActiQ9UKW4, 15 interactors
MINTiQ9UKW4
STRINGi9606.ENSP00000359073

PTM databases

iPTMnetiQ9UKW4
PhosphoSitePlusiQ9UKW4

Polymorphism and mutation databases

BioMutaiVAV3
DMDMi12643372

Proteomic databases

EPDiQ9UKW4
PaxDbiQ9UKW4
PeptideAtlasiQ9UKW4
PRIDEiQ9UKW4
ProteomicsDBi84896
84897 [Q9UKW4-2]
84898 [Q9UKW4-3]
84899 [Q9UKW4-4]

Protocols and materials databases

DNASUi10451
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000370056; ENSP00000359073; ENSG00000134215 [Q9UKW4-1]
ENST00000415432; ENSP00000394897; ENSG00000134215 [Q9UKW4-3]
ENST00000527011; ENSP00000432540; ENSG00000134215 [Q9UKW4-4]
GeneIDi10451
KEGGihsa:10451
UCSCiuc001dvj.2 human [Q9UKW4-1]

Organism-specific databases

CTDi10451
DisGeNETi10451
EuPathDBiHostDB:ENSG00000134215.15
GeneCardsiVAV3
HGNCiHGNC:12659 VAV3
HPAiCAB002012
MIMi605541 gene
neXtProtiNX_Q9UKW4
OpenTargetsiENSG00000134215
PharmGKBiPA37282
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG2996 Eukaryota
ENOG410XPH6 LUCA
GeneTreeiENSGT00930000150930
HOGENOMiHOG000234364
HOVERGENiHBG018066
InParanoidiQ9UKW4
KOiK05730
OMAiAKQDRHI
OrthoDBiEOG091G01O3
PhylomeDBiQ9UKW4
TreeFamiTF316171

Enzyme and pathway databases

ReactomeiR-HSA-114604 GPVI-mediated activation cascade
R-HSA-193648 NRAGE signals death through JNK
R-HSA-194840 Rho GTPase cycle
R-HSA-2029482 Regulation of actin dynamics for phagocytic cup formation
R-HSA-2424491 DAP12 signaling
R-HSA-2871796 FCERI mediated MAPK activation
R-HSA-2871809 FCERI mediated Ca+2 mobilization
R-HSA-3928665 EPH-ephrin mediated repulsion of cells
R-HSA-416482 G alpha (12/13) signalling events
R-HSA-4420097 VEGFA-VEGFR2 Pathway
R-HSA-5218920 VEGFR2 mediated vascular permeability
SignaLinkiQ9UKW4
SIGNORiQ9UKW4

Miscellaneous databases

ChiTaRSiVAV3 human
EvolutionaryTraceiQ9UKW4
GeneWikiiVAV3
GenomeRNAii10451
PROiPR:Q9UKW4
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000134215 Expressed in 203 organ(s), highest expression level in tongue squamous epithelium
CleanExiHS_VAV3
ExpressionAtlasiQ9UKW4 baseline and differential
GenevisibleiQ9UKW4 HS

Family and domain databases

CDDicd00029 C1, 1 hit
cd00014 CH, 1 hit
cd01223 PH_Vav, 1 hit
cd00160 RhoGEF, 1 hit
cd10407 SH2_Vav3, 1 hit
cd11978 SH3_VAV3_2, 1 hit
Gene3Di1.10.418.10, 1 hit
1.20.900.10, 1 hit
2.30.29.30, 1 hit
3.30.505.10, 1 hit
InterProiView protein in InterPro
IPR022613 CAMSAP_CH
IPR001715 CH-domain
IPR036872 CH_dom_sf
IPR035899 DBL_dom_sf
IPR000219 DH-domain
IPR001331 GDS_CDC24_CS
IPR002219 PE/DAG-bd
IPR011993 PH-like_dom_sf
IPR001849 PH_domain
IPR037832 PH_Vav
IPR000980 SH2
IPR036860 SH2_dom_sf
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain
IPR003096 SM22_calponin
IPR035881 VAV3_SH2
IPR035734 VAV3_SH3_2
PfamiView protein in Pfam
PF00130 C1_1, 1 hit
PF11971 CAMSAP_CH, 1 hit
PF00169 PH, 1 hit
PF00621 RhoGEF, 1 hit
PF00017 SH2, 1 hit
PF07653 SH3_2, 2 hits
PRINTSiPR00401 SH2DOMAIN
PR00452 SH3DOMAIN
PR00888 SM22CALPONIN
SMARTiView protein in SMART
SM00109 C1, 1 hit
SM00033 CH, 1 hit
SM00233 PH, 1 hit
SM00325 RhoGEF, 1 hit
SM00252 SH2, 1 hit
SM00326 SH3, 2 hits
SUPFAMiSSF47576 SSF47576, 1 hit
SSF48065 SSF48065, 1 hit
SSF50044 SSF50044, 2 hits
SSF55550 SSF55550, 1 hit
PROSITEiView protein in PROSITE
PS50021 CH, 1 hit
PS00741 DH_1, 1 hit
PS50010 DH_2, 1 hit
PS50003 PH_DOMAIN, 1 hit
PS50001 SH2, 1 hit
PS50002 SH3, 2 hits
PS00479 ZF_DAG_PE_1, 1 hit
PS50081 ZF_DAG_PE_2, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiVAV3_HUMAN
AccessioniPrimary (citable) accession number: Q9UKW4
Secondary accession number(s): B1AMM0
, B1APV5, B4E232, B7ZLR1, E9PQ97, O60498, O95230, Q9Y5X8
Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 24, 2001
Last sequence update: May 1, 2000
Last modified: November 7, 2018
This is version 184 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again